DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and Mycl

DIOPT Version :9

Sequence 1:NP_001259204.1 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001290050.1 Gene:Mycl / 16918 MGIID:96799 Length:398 Species:Mus musculus


Alignment Length:302 Identity:57/302 - (18%)
Similarity:108/302 - (35%) Gaps:100/302 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 ETPSDSD-EEIDVVSYTDKKLPTNPSCHLMGALQFQMAHKISIDHMKQKPRYNNFNLPYTPASSS 467
            |:||||: ||||||:...::           :|..:....|::......|...:|::        
Mouse   190 ESPSDSEGEEIDVVTVEKRR-----------SLDIRKPVTITVRADPLDPCMKHFHI-------- 235

  Fly   468 PVKSVANSRYPSPSSTPYQNCS-SASPSYSPLSVDSSNVSSSSSSSSSQSSFTTSSSNKGRKRSS 531
               |:...::...:..|.::|| ...|...| ..::..:.:.......:..         .:...
Mouse   236 ---SIHQQQHNYAARFPPESCSQEGDPEPGP-QEEAPEIEAPKEKEEEEEE---------EEEEE 287

  Fly   532 LKDPGLLISSSSVYLPGVNNKVTHSSMMSKKSRGKKVVGTSSGNTSPISSGQDVDAMDRNWQRRS 596
            :..|           |.|.::...|.                 :..|:||               
Mouse   288 IVSP-----------PPVGSEAPQSC-----------------HPKPVSS--------------- 309

  Fly   597 GGIATSTSSNSSVHRKDFVLGFDEADTIEKRNQHNDMERQRRIGLKNLFEALKKQIPTIRDKERA 661
                                   :.:.:.||..||.:||:||..|::.|.||:.|:||:....:|
Mouse   310 -----------------------DTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKA 351

  Fly   662 PKVNILREAAKLCIQLTQEEKELSMQRQLLSLQLKQRQDTLA 703
            |||.||.:|.:....|...||:::.:::.|..:.:|.|..:|
Mouse   352 PKVVILSKALEYLQALVGAEKKMATEKRQLRCRQQQLQKRIA 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_001259204.1 HLH 625..682 CDD:238036 23/56 (41%)
MyclNP_001290050.1 Myc_N 26..249 CDD:279405 16/80 (20%)
HLH 313..367 CDD:238036 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11577
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43695
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.