DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and MXD4

DIOPT Version :10

Sequence 1:NP_525062.2 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_006445.1 Gene:MXD4 / 10608 HGNCID:13906 Length:209 Species:Homo sapiens


Alignment Length:111 Identity:33/111 - (29%)
Similarity:55/111 - (49%) Gaps:18/111 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   615 VLGFDEADTIEK-------------RNQHNDMERQRRIGLKNLFEALKKQIPTIRDKERAPKVNI 666
            ||.||.....||             |:.||::|:.||..|:...|.||:.:|...|..|...:::
Human    30 VLPFDGDFAREKTKAAGLVRKAPNNRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSL 94

  Fly   667 LREAAKLCIQLTQEE--KELSMQRQLLSLQ--LKQRQDTLASYQME 708
            |:. ||:.|:..:|:  :.||::.||....  ||:|.:.|:...:|
Human    95 LKR-AKVHIKKLEEQDRRALSIKEQLQQEHRFLKRRLEQLSVQSVE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_525062.2 bHLHzip_Myc 626..702 CDD:381406 26/92 (28%)
MXD4NP_006445.1 Interaction with SIN3A and SIN3B. /evidence=ECO:0000250 6..23
bHLHzip_Mad4 53..140 CDD:381499 27/88 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..209 33/111 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.