DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLF and Irbp18

DIOPT Version :9

Sequence 1:XP_005257326.1 Gene:HLF / 3131 HGNCID:4977 Length:296 Species:Homo sapiens
Sequence 2:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster


Alignment Length:104 Identity:22/104 - (21%)
Similarity:43/104 - (41%) Gaps:15/104 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   187 IPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKQDDKYWARRRKNNMAAKRSRDARRLKE 251
            :|.::.......|.|:..|.|.               ..|..|..:|:|||.|.:|:|:..:...
  Fly     1 MPAKKRTAASTSKNSDSPLSPH---------------TDDPAYKEKRKKNNEAVQRTREKTKKSA 50

Human   252 NQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYE 290
            .:...|...|.|:|.||:.::....|.:...::::.:.|
  Fly    51 EERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGE 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLFXP_005257326.1 bZIP_HLF 226..284 CDD:269843 16/57 (28%)
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 16/58 (28%)
coiled coil 25..83 CDD:269841 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.