DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnc and PDE6B

DIOPT Version :9

Sequence 1:NP_726846.1 Gene:dnc / 31309 FlyBaseID:FBgn0000479 Length:1209 Species:Drosophila melanogaster
Sequence 2:XP_011511775.1 Gene:PDE6B / 5158 HGNCID:8786 Length:941 Species:Homo sapiens


Alignment Length:388 Identity:99/388 - (25%)
Similarity:171/388 - (44%) Gaps:60/388 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   800 ENELGTLLGELDTWGIQIFSIGEFSVNRPLTCV-------AYTIFQSRELLTSLMIPPKTFLNFM 857
            |:|||.:|.| :..|...|.|.||..: .|.|.       ...::....::....||.:..:.|:
Human   555 EDELGEILKE-ELPGPTTFDIYEFHFS-DLECTELDLVKCGIQMYYELGVVRKFQIPQEVLVRFL 617

  Fly   858 STLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQF 922
            .::...| :...:||..|..:|.|:...||.|..|:..:|.||....:.|...||:||.|..|.:
Human   618 FSISKGY-RRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDIDHRGTNNLY 681

  Fly   923 LVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKH 987
            .:.|.:.||.::. .|:||.|||.....||..:..:|:.|:.::|.:.:..::...:::||::.:
Human   682 QMKSQNPLAKLHG-SSILERHHLEFGKFLLSEETLNIYQNLNRRQHEHVIHLMDIAIIATDLALY 745

  Fly   988 MSLLADLKTMVETKKVAGSGVLLLDNYTDRIQ--------------VLENLVHCADLSNPTKPLP 1038
            ....|..:.:|:..|          ||.|:..              |:..::...|||..|||..
Human   746 FKKRAMFQKIVDESK----------NYQDKKSWVEYLSLETTRKEIVMAMMMTACDLSAITKPWE 800

  Fly  1039 LYKRWVALLMEEFFLQGDKERESGMDIS--PMCDRHNAT-IEKSQVGFIDYIVHPLWETWADLVH 1100
            :..:...|:..||:.|||.|| :.:|..  ||.||:.|. :.|.||||||::...:::.::.. |
Human   801 VQSKVALLVAAEFWEQGDLER-TVLDQQPIPMMDRNKAAELPKLQVGFIDFVCTFVYKEFSRF-H 863

  Fly  1101 PDAQDILDTLEENRDYYQS--------------------MIPPSPPPSGVDENPQEDRIRFQV 1143
            .:...:.|.|:.||..:::                    :.|.|..|.|....||....|..|
Human   864 EEILPMFDRLQNNRKEWKALADDRHRNLQWRPSTQVFNLLYPVSTGPMGTLWLPQSSPTRIWV 926

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dncNP_726846.1 PDEase_I 870..1111 CDD:278654 71/257 (28%)
PDE6BXP_011511775.1 GAF 144..303 CDD:214500
GAF 325..512 CDD:214500
PDEase_I 629..874 CDD:278654 71/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.