DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnc and PDE6A

DIOPT Version :9

Sequence 1:NP_726846.1 Gene:dnc / 31309 FlyBaseID:FBgn0000479 Length:1209 Species:Drosophila melanogaster
Sequence 2:NP_000431.2 Gene:PDE6A / 5145 HGNCID:8785 Length:860 Species:Homo sapiens


Alignment Length:390 Identity:104/390 - (26%)
Similarity:184/390 - (47%) Gaps:38/390 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   800 ENELGTLL-GEL---DTWGIQIFSIGEFSVNRPLT------CVAYTIFQSRELLTSLMIPPKTFL 854
            |.||..:| .||   |.:.|..|...:.    |||      | ...::...:::....||.:..:
Human   484 EEELAEILQAELPDADKYEINKFHFSDL----PLTELELVKC-GIQMYYELKVVDKFHIPQEALV 543

  Fly   855 NFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLT 919
            .||.:|...|.|.. :||..|..:|.|:...||.|..|:..||.||....:.||..||:||.|..
Human   544 RFMYSLSKGYRKIT-YHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHDIDHRGTN 607

  Fly   920 NQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDM 984
            |.:.:.|.:.||.::. .|:||.|||.....||:::..:||.|:.::|.:....|:...:::||:
Human   608 NLYQMKSQNPLAKLHG-SSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIHMMDIAIIATDL 671

  Fly   985 SKHMSLLADLKTMVETKKVAGS-----GVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWV 1044
            :.:.......:.:|:..|...|     ..::|:.....| |:..::...|||..|||..:..:..
Human   672 ALYFKKRTMFQKIVDQSKTYESEQEWTQYMMLEQTRKEI-VMAMMMTACDLSAITKPWEVQSQVA 735

  Fly  1045 ALLMEEFFLQGDKERE-SGMDISPMCDRHNA-TIEKSQVGFIDYIVHPLWETWADLVHPDAQDIL 1107
            .|:..||:.|||.||. ...:..||.||:.| .:.|.||||||::...:::.::.. |.:...:|
Human   736 LLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFVCTFVYKEFSRF-HEEITPML 799

  Fly  1108 DTLEENRDYYQSMIPPSPPPSGVDENPQEDRIRFQVTLEESDQENLAELEEGDESGGESTTTGTT 1172
            |.:..||..::::         .||...:.:::.:   ::..|::......|::.||..:..|.|
Human   800 DGITNNRKEWKAL---------ADEYDAKMKVQEE---KKQKQQSAKSAAAGNQPGGNPSPGGAT 852

  Fly  1173  1172
            Human   853  852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dncNP_726846.1 PDEase_I 870..1111 CDD:278654 74/247 (30%)
PDE6ANP_000431.2 GAF 75..232 CDD:214500
GAF 254..441 CDD:214500
PDEase_I 558..802 CDD:365964 74/246 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 821..860 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.