DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnc and pde6a

DIOPT Version :9

Sequence 1:NP_726846.1 Gene:dnc / 31309 FlyBaseID:FBgn0000479 Length:1209 Species:Drosophila melanogaster
Sequence 2:NP_001007161.1 Gene:pde6a / 368410 ZFINID:ZDB-GENE-030616-42 Length:858 Species:Danio rerio


Alignment Length:383 Identity:94/383 - (24%)
Similarity:175/383 - (45%) Gaps:49/383 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   800 ENELGTLLGEL--DTWGIQIFSIG----EFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMS 858
            |:||..:|.|:  |:...:||...    |||....:.| ...::....::....||.:|.:.|:.
Zfish   485 EDELEDILNEVLPDSEESEIFEFHFCDFEFSELDLVKC-GIKMYYELGVVDKFHIPRETLVRFVY 548

  Fly   859 TLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFL 923
            ::...|.|.. :||..|..:|.|:...||.|..|:..:|.||....:.|...||:||.|..|.:.
Zfish   549 SVSKGYRKIT-YHNWRHGFNVGQTMFTLLMTGDLKRYYTDLEAMAMVTAGLCHDIDHRGTNNLYQ 612

  Fly   924 VNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHM 988
            :.|.:.||.::. .|:||.|||.....||:::..:|:.|:.::|.:|:..::...:::||::.:.
Zfish   613 MKSGNPLAKLHG-SSILERHHLEFGKTLLRDEALNIYQNLNRRQHETVIHLMDIAIIATDLALYF 676

  Fly   989 SLLADLKTMVETKKVAGSGVLLLDNYTDRIQ--------VLENLVHCADLSNPTKPLPLYKRWVA 1045
            ......:.:|:..|...|    .|::|..:.        |:..::...|||...||..:..:...
Zfish   677 KKRTMFQKIVDQSKTYDS----WDSWTKYMMLETTRKEIVMAMMMTACDLSAIAKPWEIQSKVAL 737

  Fly  1046 LLMEEFFLQGDKERE-SGMDISPMCDRHNA-TIEKSQVGFIDYIVHPLWETWADLVHPDAQDILD 1108
            .:..||:.|||.||. ......||.||:.| .:.|.|.||||::...:::.::.. |.:...:|:
Zfish   738 SVAAEFWEQGDLERTVLEQQPIPMMDRNKAEELPKLQCGFIDFVCSFVYKEFSRF-HVEITPMLE 801

  Fly  1109 TLEENRDYYQSMIPPSPPPSGVDENPQEDRIRFQVTLEESDQENLAELEEGDESGGES 1166
            .|..||..:.:                         |:|..:..:|:|:|..::..|:
Zfish   802 RLLNNRKEWNA-------------------------LKEIHEAKVAKLDEAKKAKEEA 834

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dncNP_726846.1 PDEase_I 870..1111 CDD:278654 67/250 (27%)
pde6aNP_001007161.1 GAF 74..233 CDD:214500
GAF 255..442 CDD:214500
PDEase_I 559..803 CDD:278654 67/249 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.