DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnc and Pde6c

DIOPT Version :9

Sequence 1:NP_726846.1 Gene:dnc / 31309 FlyBaseID:FBgn0000479 Length:1209 Species:Drosophila melanogaster
Sequence 2:NP_001101992.1 Gene:Pde6c / 361752 RGDID:1309844 Length:861 Species:Rattus norvegicus


Alignment Length:587 Identity:134/587 - (22%)
Similarity:236/587 - (40%) Gaps:150/587 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   616 VRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGEEAYTR----------LATDTIEEL 670
            |..|:|||   |..||  :.:....|:......|.|..:.:|..|.          |.|||.|.:
  Rat   383 VIKNVLSL---PIVNK--KEDIVGVATFYNRKDGKPFDEHDEHITETLTQFLGWSLLNTDTYERV 442

  Fly   671 DWCLDQLETIQ------THRSVSDMAS-LKFKRMLNKELSHFSESSRSGNQISEYICSTFLDKQQ 728
            :....:.:..|      |..:.|:::| ||||..||.::                     :::.:
  Rat   443 NKLESRKDIAQEMIMNLTKATPSEISSILKFKEKLNIDV---------------------IEECE 486

  Fly   729 EFDLPSLRVEDNPELVAANAAAGQQSAGQYARSRSPRGPPMSQISGVKRPLSHTNSFTGERLPTF 793
            |..|.::..|:.|:                     ||...:.:.                |...|
  Rat   487 ERQLLAILKEELPD---------------------PRAADLYEF----------------RFSDF 514

  Fly   794 GVETPRENELGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMS 858
            .|   .|:||...       |:::|    ..:|               ::....:|.:....:|.
  Rat   515 PV---TEHELVKC-------GLRLF----LEIN---------------VVEKFKVPVEVLTRWMY 550

  Fly   859 TLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFL 923
            |:...| :...:||..|..:|.|:...||.|..|:..:|.||....|.||..||:||.|..|.:.
  Rat   551 TVRKGY-RPVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAFCHDIDHRGTNNLYQ 614

  Fly   924 VNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHM 988
            :.|:|.||.::. .|:||.|||..:..|||::..:||.|:.|:|.:|:..:....:::||::.:.
  Rat   615 MKSTSPLARLHG-TSILERHHLEYSKTLLQDESLNIFQNLSKRQFETVIHLFEVAIIATDLALYF 678

  Fly   989 SLLADLKTMVET-----------KKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKR 1042
            ......:.:|:|           |.|..       :.|.:..::..::...|||..|||..:..:
  Rat   679 KKRTMFQKIVDTCEQMQSEEETIKYVTA-------DPTKKEVIMAMMMTACDLSAITKPWEVQSQ 736

  Fly  1043 WVALLMEEFFLQGDKERE-SGMDISPMCDRH-NATIEKSQVGFIDYIVHPLWETWADLVHPDAQD 1105
            ...|:..||:.|||.||. ......||.||: ...:.|.||||||::...:::.::.. |.:...
  Rat   737 ATLLVANEFWEQGDLERTVLQQQPIPMMDRNKKGELPKLQVGFIDFVCTFVYKEFSRF-HGEITP 800

  Fly  1106 ILDTLEENRDYYQSMIPPSPPPSGVDENPQEDRIRFQVTLEESDQENLAELEEGDESGGESTTTG 1170
            :|..|:.||..::|:             .:|...:.:||     :|.:.:.||....|..:|..|
  Rat   801 MLTGLQNNRVEWKSL-------------AEEYEAKVKVT-----EEEVGKQEEVTSDGKAATDLG 847

  Fly  1171 TT 1172
            ::
  Rat   848 SS 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dncNP_726846.1 PDEase_I 870..1111 CDD:278654 74/253 (29%)
Pde6cNP_001101992.1 GAF 81..232 CDD:214500
GAF 256..443 CDD:214500 18/64 (28%)
PDEase_I 561..806 CDD:278654 74/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.