DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnc and Pde6b

DIOPT Version :9

Sequence 1:NP_726846.1 Gene:dnc / 31309 FlyBaseID:FBgn0000479 Length:1209 Species:Drosophila melanogaster
Sequence 2:NP_001099494.1 Gene:Pde6b / 289878 RGDID:1311039 Length:856 Species:Rattus norvegicus


Alignment Length:415 Identity:105/415 - (25%)
Similarity:190/415 - (45%) Gaps:58/415 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   788 ERLPT---FGVETP--RENELGTLLGELDTWGIQIFSIGEFSVNRPLTCV-------AYTIFQSR 840
            |.|||   .|.|..  .|:|||.:|.| :..|...|.|.||..: .|.|.       ...::...
  Rat   465 EILPTRDRLGKEPADCEEDELGKILKE-ELPGPTKFDIYEFHFS-DLECTELELVKCGIQMYYEL 527

  Fly   841 ELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGAL 905
            .::....||.:..:.|:.::...| :...:||..|..:|.|:...||.|..|:..:|.||....:
  Rat   528 GVVRKFQIPQEVLVRFLFSVSKAY-RRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMV 591

  Fly   906 FAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQT 970
            .|...||:||.|..|.:.:.|.:.||.::. .|:||.|||.....||..:..:|:.|:.::|.:.
  Rat   592 TAGLCHDIDHRGTNNLYQMKSQNPLAKLHG-SSILERHHLEFGKFLLAEESLNIYQNLNRRQHEH 655

  Fly   971 LRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQ--------------VL 1021
            :..::...:::||::.:.......:.:|:..|          ||.|:..              |:
  Rat   656 VIHLMDIAIIATDLALYFKKRTMFQKIVDESK----------NYEDKKSWVEYLSLETTRKEIVM 710

  Fly  1022 ENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDIS--PMCDRHNAT-IEKSQVGF 1083
            ..::...|||..|||..:..:...|:..||:.|||.|| :.:|..  ||.||:.|. :.|.||||
  Rat   711 AMMMTACDLSAITKPWEVQSKVALLVAAEFWEQGDLER-TVLDQQPIPMMDRNKAAELPKLQVGF 774

  Fly  1084 IDYIVHPLWETWADLVHPDAQDILDTLEENRDYYQSMIPPSPPPSGVDENPQEDRIRFQVTLEES 1148
            ||::...:::.::.. |.:...:.|.|:.||..::::         .||  .|.:::.....::.
  Rat   775 IDFVCTFVYKEFSRF-HEEILPMFDRLQNNRKEWKAL---------ADE--YEAKVKALEEEKKK 827

  Fly  1149 DQENLAELEEGDE--SGGESTTTGT 1171
            :::.:|..:.|.|  :||.:..:.|
  Rat   828 EEDRVAAKKAGTEICNGGPAPKSST 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dncNP_726846.1 PDEase_I 870..1111 CDD:278654 70/257 (27%)
Pde6bNP_001099494.1 GAF 71..230 CDD:214500
GAF 252..439 CDD:214500
PDEase_I 556..801 CDD:278654 70/257 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.