DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnc and PDE7B

DIOPT Version :9

Sequence 1:NP_726846.1 Gene:dnc / 31309 FlyBaseID:FBgn0000479 Length:1209 Species:Drosophila melanogaster
Sequence 2:NP_061818.1 Gene:PDE7B / 27115 HGNCID:8792 Length:450 Species:Homo sapiens


Alignment Length:397 Identity:117/397 - (29%)
Similarity:196/397 - (49%) Gaps:28/397 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   775 VKRPLSHTNSFTGERL-----PTFGVETPRENELGT---LLGELDTWGIQIFSIGEFSVNRPLTC 831
            |||.||....|...||     |...:....|:.||.   :|.::..|...||.....:....|..
Human    69 VKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIFLFDRLTNGNSLVT 133

  Fly   832 VAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVF 896
            :...:|.:..|:....:...|...|:..:::.|...||:||::|||||||:.:..|..|.|....
Human   134 LLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASFL 198

  Fly   897 TPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFC 961
            |||::...|.||..|||||||:...||:.::..||.:|.:.|||||||......:|:..  .:..
Human   199 TPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRES--RLLA 261

  Fly   962 NMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVH 1026
            ::.|:..|.:.:.:..::|:||:::....|..||..:..|.      |.|::..||..:|:..:.
Human   262 HLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHNKD------LRLEDAQDRHFMLQIALK 320

  Fly  1027 CADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHNATIEKSQVGFIDYIVHPL 1091
            |||:.||.:...:.|:|...:.|||:.||:.|::..::|||:|::...:|...|:||:.|||.||
Human   321 CADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPL 385

  Fly  1092 WETWADLVHPD--AQDILDTLEENRDYYQSMIPPSPPPSGVD-ENPQEDRIRFQVTLEESDQENL 1153
            :..||......  ::::|..|..|:..::|::|......|.. ..|..|         .:.|...
Human   386 FREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQHRSRGSSGSGPDHD---------HAGQGTE 441

  Fly  1154 AELEEGD 1160
            :|.:|||
Human   442 SEEQEGD 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dncNP_726846.1 PDEase_I 870..1111 CDD:278654 81/242 (33%)
PDE7BNP_061818.1 PDEase_I 172..392 CDD:278654 80/227 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..450 9/40 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.