DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10793 and RPT2b

DIOPT Version :10

Sequence 1:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0288967 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_179604.1 Gene:RPT2b / 816533 AraportID:AT2G20140 Length:443 Species:Arabidopsis thaliana


Alignment Length:251 Identity:84/251 - (33%)
Similarity:139/251 - (55%) Gaps:23/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 ILQENI-------KIK------WSDVCGNQRAIELIKEAVLTPIEFPQLFAH-GLKPWRSLLLHG 246
            |||:.:       |::      ::|:.|.:..|:.|||||..|:..|:|:.. |:||.:.::|:|
plant   165 ILQDEVDPMVSVMKVEKAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYG 229

  Fly   247 PPGSGKTLLAKALYSETQGQVTFFNITASIMVSKWRGESEKILRVLFHMAAKRAPSVIFFDEIES 311
            .||:||||||||:.:.|  ..||..:..|.::.|:.|:..|::|.||.:|...:||::|.|||::
plant   230 EPGTGKTLLAKAVANST--SATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDA 292

  Fly   312 LTSKRDRATD--HESSKRFKNELLQLLDGMEHSLNGVFVLASTNLPWDIDEAFLR--RFEKKLLV 372
            :.:||..|..  ....:|...|||..|||.: |...|.|:.:||....:|.|.||  |.::|:..
plant   293 VGTKRYDANSGGEREIQRTMLELLNQLDGFD-SRGDVKVILATNRIESLDPALLRPGRIDRKIEF 356

  Fly   373 QLPNAAERSCLINRLLGSSISLNPRL-LEQLVEISDHFTGDEIRLACKEISMHRVR 427
            .||:...|. .|.::..|.::|...: ||:.|...|.|:|.:|:..|.|..:..:|
plant   357 PLPDIKTRR-RIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10793NP_570054.2 LisH 31..55 CDD:462501
RecA-like_VPS4-like 208..372 CDD:410917 63/168 (38%)
RPT2bNP_179604.1 PTZ00361 7..443 CDD:185575 84/251 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.