DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10793 and Psmc1

DIOPT Version :10

Sequence 1:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0288967 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_032973.1 Gene:Psmc1 / 19179 MGIID:106054 Length:440 Species:Mus musculus


Alignment Length:210 Identity:35/210 - (16%)
Similarity:66/210 - (31%) Gaps:84/210 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDVEDEYEDEEEIEEDEPVADENQEPEAEEPEAEEEAPAPAAASPRAAAPPASLKSPTPGRQQV 65
            |:.|..|:|::..:|.||                                          ||:.|
Mouse   277 MTAVVKEFEEKGLVEVDE------------------------------------------GRKIV 299

  Fly    66 NFTP--SIPQSVLRKQQNYSSGKPSTIHTKEKLMRSEGIIPIQAGSNKYASQKG----------- 117
             |.|  |||.::::....|:.........:.:|...:..|.|      |.:..|           
Mouse   300 -FAPGQSIPLTIVKSDGGYTYDTSDLAAIRNRLFDEKADIII------YVTDSGQAMHFQVIFAA 357

  Fly   118 --MTGFGVPRDVIDKVKSDNLAEITDEKKIANLKGSTWLQSGTNKFASQKGQSGFGAVRDVNYKT 180
              :.|:..|:  :.:|:......:..|.|              .||.::.|.:    ||.::...
Mouse   358 AQLIGWYDPK--VTRVEHAGFGVVLGEDK--------------KKFKTRSGDT----VRLMDLLE 402

  Fly   181 KGTGGASEVPEEKAR 195
            :|...:.:..:||.|
Mouse   403 EGLKRSMDKLKEKER 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10793NP_570054.2 LisH 31..55 CDD:462501 0/23 (0%)
RecA-like_VPS4-like 208..372 CDD:410917
Psmc1NP_032973.1 PTZ00361 1..440 CDD:185575 35/210 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.