DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10793 and C10G11.8

DIOPT Version :10

Sequence 1:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0288967 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001379656.1 Gene:C10G11.8 / 172324 WormBaseID:WBGene00015688 Length:438 Species:Caenorhabditis elegans


Alignment Length:241 Identity:75/241 - (31%)
Similarity:132/241 - (54%) Gaps:10/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 LQENIKIKWSDVCGNQRAIELIKEAVLTPIEFPQLFAH-GLKPWRSLLLHGPPGSGKTLLAKALY 260
            :::..|..:.|:.|.:..|:.:||:|..|:..|:.:.. |:...:.::|:|.||:||||||||:.
 Worm   174 VEKTPKETFDDIGGCESQIQELKESVELPLTHPEYYEEMGITAPKGVILYGEPGTGKTLLAKAVA 238

  Fly   261 SETQGQVTFFNITASIMVSKWRGESEKILRVLFHMAAKRAPSVIFFDEIESLTSKR-DRATDHES 324
            :.|  ..||...|.|.:|.|..||..:::|.:|.||.::|||::|.|||:::.:|| |.::..|.
 Worm   239 NST--SATFIRATGSDLVQKQSGEGARLVRQIFQMAKEQAPSIVFIDEIDAVGTKRFDTSSRGEQ 301

  Fly   325 S-KRFKNELLQLLDGMEHSLNGVFVLASTNLPWDIDEAFLR--RFEKKLLVQLPNAAERSCLINR 386
            . :|...|||..|||.| |...|.::.:||....:|.|.:|  |.::|:.:..|:...|..:.. 
 Worm   302 EVQRTLLELLNQLDGFE-SRGDVKIIMATNRIDSLDPALIRPGRIDRKIELPKPDEKTRQKIFT- 364

  Fly   387 LLGSSISLNPRL-LEQLVEISDHFTGDEIRLACKEISMHRVRCATK 431
            :..|.:::...: .|.::......:|.||:..|.|..|..:|...|
 Worm   365 IHTSGMTIQKAVTYENVLGKEKSISGAEIKAVCTEAGMLALRAQRK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10793NP_570054.2 LisH 31..55 CDD:462501
RecA-like_VPS4-like 208..372 CDD:410917 61/168 (36%)
C10G11.8NP_001379656.1 PTZ00361 9..437 CDD:185575 75/241 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.