DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10793 and LOC1272835

DIOPT Version :10

Sequence 1:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0288967 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_311752.4 Gene:LOC1272835 / 1272835 VectorBaseID:AGAMI1_004213 Length:602 Species:Anopheles gambiae


Alignment Length:76 Identity:18/76 - (23%)
Similarity:33/76 - (43%) Gaps:12/76 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KVEMGGGKAHEKTPAK-------ELPKKPPTTDASLANWHIGVGAATQALSNEQPLQ-----IKK 152
            |:.:||..:.::...:       .|.::|.|:..:.....:..|.||:.||.:|..|     |..
Mosquito   460 KLTVGGDLSEQRALVQLLSDLNGVLVERPQTSTPACLGAMLAAGLATEILSIDQFRQNCVPPIDL 524

  Fly   153 METATESNGQD 163
            ..||..|:.:|
Mosquito   525 FSTAFNSSQRD 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10793NP_570054.2 LisH 31..55 CDD:462501
RecA-like_VPS4-like 208..372 CDD:410917
LOC1272835XP_311752.4 ASKHA_ATPase-like 14..548 CDD:483947 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.