DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgs4 and 9530068E07Rik

DIOPT Version :9

Sequence 1:NP_476717.4 Gene:Sgs4 / 31304 FlyBaseID:FBgn0003374 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_694757.1 Gene:9530068E07Rik / 213673 MGIID:2654705 Length:259 Species:Mus musculus


Alignment Length:120 Identity:26/120 - (21%)
Similarity:39/120 - (32%) Gaps:8/120 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CTKRIKRHRTKRTKRSKSTKKIVHHHNRPGTTPESGCGCGSKNESGGGGSGCILKDLLTPKCPDS 231
            |:.|.:......|..|........:|..|..:..|.....:..|..|..|..     .||....|
Mouse    44 CSDRSENPPNNATVSSPVVVTAPGNHTSPSVSQISTTLSPASAEKSGSSSAA-----PTPTAAPS 103

  Fly   232 KSKSQASCKPAPKC-KSDPKPKAASKATSKPKPKACDSGKK--NTTKKPRKTQPQ 283
            ..:.:|.....|.. :.|.....:|.||.|......|.|:.  :.|..||..:|:
Mouse   104 APEEEADSNEDPSMEEEDLLALNSSPATGKDTLDNGDYGEPDYDWTTNPRDEEPE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgs4NP_476717.4 PTZ00436 <18..158 CDD:185616
9530068E07RikNP_694757.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..155 24/112 (21%)
MSP1_C <50..>168 CDD:284802 24/114 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7125
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.