DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3939 and AT5G42850

DIOPT Version :9

Sequence 1:NP_001284837.1 Gene:CG3939 / 31295 FlyBaseID:FBgn0040396 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_568614.1 Gene:AT5G42850 / 834296 AraportID:AT5G42850 Length:134 Species:Arabidopsis thaliana


Alignment Length:106 Identity:36/106 - (33%)
Similarity:49/106 - (46%) Gaps:24/106 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IKLYENQRSPI-YIYFYGEKD-KDGRSWCPDCVAAEETIMSAFRNHAPADCMILVVDVGSRESWI 79
            :|..|..||.| :|.|..:.| ..|:|||||||.||..|....... |.:..::....|.|.:| 
plant    20 LKSDETSRSKINFILFLADNDPTTGQSWCPDCVRAEPVIYKTLEEF-PEEVKLIRAYAGDRPTW- 82

  Fly    80 GKDNMFRKP--PYSVE------GIPTLIRWKGVERLDGDQL 112
                  |.|  |:.|:      |:|||:||      |||.:
plant    83 ------RTPAHPWRVDSRFKLTGVPTLVRW------DGDSV 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3939NP_001284837.1 DUF953 6..124 CDD:283713 36/106 (34%)
AT5G42850NP_568614.1 DUF953 1..120 CDD:283713 36/106 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3813
eggNOG 1 0.900 - - E1_KOG3425
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I2542
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624076at2759
OrthoFinder 1 1.000 - - FOG0003910
OrthoInspector 1 1.000 - - otm3466
orthoMCL 1 0.900 - - OOG6_103445
Panther 1 1.100 - - LDO PTHR12452
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3213
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.