powered by:
Protein Alignment CG3939 and Nxnl1
DIOPT Version :9
Sequence 1: | NP_001284837.1 |
Gene: | CG3939 / 31295 |
FlyBaseID: | FBgn0040396 |
Length: | 135 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001258270.1 |
Gene: | Nxnl1 / 306342 |
RGDID: | 1308296 |
Length: | 217 |
Species: | Rattus norvegicus |
Alignment Length: | 46 |
Identity: | 10/46 - (21%) |
Similarity: | 17/46 - (36%) |
Gaps: | 6/46 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 EMENLIKLYENQRSPIYIYFYGEKDKDGRSWCPDCVAAEETIMSAF 57
|:|...:|.....:.:.:.|: |...||.|.|....:...|
Rat 19 EVETEAELSRRLENRLVLLFF------GAGACPQCQAFAPVLKDFF 58
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1624076at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.