DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3939 and Txndc17

DIOPT Version :9

Sequence 1:NP_001284837.1 Gene:CG3939 / 31295 FlyBaseID:FBgn0040396 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001099275.1 Gene:Txndc17 / 287474 RGDID:1308868 Length:123 Species:Rattus norvegicus


Alignment Length:122 Identity:42/122 - (34%)
Similarity:68/122 - (55%) Gaps:4/122 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYVPARGFKEMENLIKLYENQRSPIYIYFYGEKDKDGRSWCPDCVAAEETIMSAFRNHAPADCMI 67
            |.|...||:|.:..:|  |:|...|:.:|.|.||.:|:|||||||.||..|....: |...||:.
  Rat     5 EEVSVLGFEEFDKAVK--EHQGKTIFAFFSGSKDTEGKSWCPDCVEAEPIIREGLK-HVTEDCVF 66

  Fly    68 LVVDVGSRESWIGKDNMFRKPPYSVEGIPTLIRWKGVERLDGDQLLKSSLLELFFEE 124
            :...||.:..|...:|.||: ...:..:|||:::...::|...:..:|:|:|:.|.|
  Rat    67 IYCQVGDKPYWKDPNNDFRQ-KLKITAVPTLLKYGTPQKLVESECRQSNLVEMIFSE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3939NP_001284837.1 DUF953 6..124 CDD:283713 39/117 (33%)
Txndc17NP_001099275.1 TRP14_like 4..121 CDD:239250 40/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346707
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3425
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52861
OrthoDB 1 1.010 - - D1624076at2759
OrthoFinder 1 1.000 - - FOG0003910
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103445
Panther 1 1.100 - - LDO PTHR12452
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3213
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.720

Return to query results.
Submit another query.