DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3939 and SPBC21C3.12c

DIOPT Version :9

Sequence 1:NP_001284837.1 Gene:CG3939 / 31295 FlyBaseID:FBgn0040396 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_596592.1 Gene:SPBC21C3.12c / 2540715 PomBaseID:SPBC21C3.12c Length:124 Species:Schizosaccharomyces pombe


Alignment Length:109 Identity:29/109 - (26%)
Similarity:49/109 - (44%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IYIYFYGEKD-KDGRSWCPDCVAAEETIMSAFRNHAPADCMILVVDVGSRESWIGKDNMFRKPPY 90
            :::.:....| :..:.|||...||.....:||.:....:  ::.|.||:...|....|.|| ..:
pombe    22 LFVAYLASVDPRTKQPWCPTVRAALPLFNNAFNSSKKLN--VVHVYVGNMPQWKTPHNEFR-VKF 83

  Fly    91 SVEGIPTLIRWKGVERLDGDQLLKSSLLELFFEETDPKK-SNFV 133
            .:..:|||    |....|....||:||| :.::..|..| |.|:
pombe    84 GISAVPTL----GKYTRDAQGNLKTSLL-VDYDCLDANKFSKFI 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3939NP_001284837.1 DUF953 6..124 CDD:283713 25/97 (26%)
SPBC21C3.12cNP_596592.1 Thioredoxin_like 18..116 CDD:294274 26/101 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3425
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003910
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103445
Panther 1 1.100 - - LDO PTHR12452
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.