DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3939 and C30H6.8

DIOPT Version :9

Sequence 1:NP_001284837.1 Gene:CG3939 / 31295 FlyBaseID:FBgn0040396 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001379185.1 Gene:C30H6.8 / 178525 WormBaseID:WBGene00007825 Length:178 Species:Caenorhabditis elegans


Alignment Length:71 Identity:17/71 - (23%)
Similarity:23/71 - (32%) Gaps:19/71 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NLIKLY-ENQRSPIYIYFYGEKDKDGRSWCPDCVAAEETIMSAFRNHAPADCMILVVDVGSRES- 77
            ||.|.| ||:  .:.:||       ...||..|......|...:.       .:...|.|.... 
 Worm    43 NLPKDYFENK--TVVVYF-------SAGWCGSCKFLTPKIKKFYN-------AVKESDAGKNLEI 91

  Fly    78 -WIGKD 82
             |:.||
 Worm    92 VWVSKD 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3939NP_001284837.1 DUF953 6..124 CDD:283713 17/71 (24%)
C30H6.8NP_001379185.1 TryX_like_family 35..172 CDD:239262 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.