DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3939 and T05F1.11

DIOPT Version :9

Sequence 1:NP_001284837.1 Gene:CG3939 / 31295 FlyBaseID:FBgn0040396 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_492564.2 Gene:T05F1.11 / 172811 WormBaseID:WBGene00011495 Length:676 Species:Caenorhabditis elegans


Alignment Length:147 Identity:36/147 - (24%)
Similarity:54/147 - (36%) Gaps:43/147 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KEMENLIKLYEN----QRSPIYIYF-----YGEKDKDGR--------SWCPDCVAAEET-IMSAF 57
            ||..|.::...|    |..|::.:.     |.|:..||:        .||..  :.:.| |::.|
 Worm   521 KEETNKMEQMNNCTFLQNVPLFRHLHPSGSYSERMLDGKVIGLYYSGYWCQP--SRDFTPILAQF 583

  Fly    58 RNHAPADCMILVVDVGSRESWI------GKDNMFRKP---PYS--------VEGIPTLIRWK--- 102
            .:....:..||.:.....|..:      ...:.|..|   |.|        ...|||||..|   
 Worm   584 YSQVDKNFEILFISSDRSEQEMNYYLQSSHGDWFHLPFDSPISKHLQQFNTKNAIPTLIIIKPNG 648

  Fly   103 GVERLDG-DQLLKSSLL 118
            .|..:|| ||:  ||.|
 Worm   649 TVITVDGRDQV--SSFL 663

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG3939NP_001284837.1 DUF953 6..124 CDD:283713 36/147 (24%)