powered by:
Protein Alignment CG3939 and NXNL2
DIOPT Version :9
Sequence 1: | NP_001284837.1 |
Gene: | CG3939 / 31295 |
FlyBaseID: | FBgn0040396 |
Length: | 135 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_011516577.1 |
Gene: | NXNL2 / 158046 |
HGNCID: | 30482 |
Length: | 208 |
Species: | Homo sapiens |
Alignment Length: | 54 |
Identity: | 11/54 - (20%) |
Similarity: | 22/54 - (40%) |
Gaps: | 0/54 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 QRSPIYIYFYGEKDKDGRSWCPDCVAAEETIMSAFRNHAPADCMILVVDVGSRE 76
|...:.:||...:....|.:.|........:::..|..||.:.:.:..|..|:|
Human 25 QNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSADGSSQE 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1624076at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.