DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and DIP-delta

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:424 Identity:102/424 - (24%)
Similarity:173/424 - (40%) Gaps:69/424 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 FAMEPQDQTAVVGSRVTLPCRVMEKVGA--LQWTKDD--FGLGQHRN-LSGFERYSMVGSDEEGD 143
            ||....:.|..||....||| |:|.:|.  :.|...|  ..|..||: :|...|||:..:|  ..
  Fly    46 FAQPIPNVTVAVGRDANLPC-VVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTD--NT 107

  Fly   144 FSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKI-TQGDYLVTTEDREIEL 207
            :.|.:.....||...|.|||...|     :.|:...|.|:|||....| :....:...|::.|.:
  Fly   108 WLLHVNQAHQDDRGYYMCQVNTNP-----MISQVGYLQVVVPPNILDIESTPSSVAVRENQNINM 167

  Fly   208 ECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQN 272
            .|.:. |.||.:|.|....|..:  .:|..|:.|     :....:|.|.....:....:.|.|.|
  Fly   168 TCRAD-GFPAPKIIWRREDGEEI--AVEKKKKVL-----VYDADVLPLTKVSRNEMGAYLCIATN 224

  Fly   273 TADRTYRSAKLLLEVKYAPKVIV--SVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDE 335
            ....:. |.:::|:|:::|.:.|  .:||.       |.|.:|.:.|..:|:|..:.| |..|..
  Fly   225 GVPPSV-SKRIILDVEFSPMIWVPNQLVGA-------PSGTDVTIDCHTEAHPKAIIY-WVYNSV 280

  Fly   336 LM------TGDFT-------TKMIIHNVSRQYHD-AIVKCEVVNAVGKSEQSKKL---------- 376
            ::      ..|:|       .|:.|.|:  ||.| ...:|...|::|::|.|.::          
  Fly   281 MVLPSKKYKTDYTENSYRAHMKLTIRNL--QYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPS 343

  Fly   377 -DISFGPV-FRQRPVSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKLKVSSET- 438
             .::...| .|:..:...:....|.|::.||....:.::...|.:|....|.::......|.:| 
  Fly   344 KQVTHTTVESRENNIIPSSRNDTTKSLQTDVGYAMKNDLYPGSASSSSSGGSSSAASSSSSMQTS 408

  Fly   439 ------AGRYFCKAVVNGFPEIGAEATLYVKRAP 466
                  ||.........|...|| ::|.|.:|.|
  Fly   409 ALPGGVAGNSLSSMGSKGSLAIG-KSTFYTERPP 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 29/100 (29%)
IG_like 88..182 CDD:214653 29/98 (30%)
C2-set_2 189..279 CDD:285423 18/90 (20%)
Ig_2 307..379 CDD:290606 22/96 (23%)
I-set 382..462 CDD:254352 17/87 (20%)
IGc2 396..446 CDD:197706 11/56 (20%)
Ig 466..561 CDD:299845 1/1 (100%)
IG_like 478..561 CDD:214653
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 30/99 (30%)
Ig 145..238 CDD:416386 21/101 (21%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 2/8 (25%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 1/6 (17%)
Ig strand G 230..238 CDD:409353 2/8 (25%)
Ig 242..333 CDD:416386 26/100 (26%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 2/5 (40%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 314..322 CDD:409353 1/7 (14%)
Ig strand G 325..334 CDD:409353 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.