DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and tmigd1

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001091718.1 Gene:tmigd1 / 559127 ZFINID:ZDB-GENE-080303-6 Length:251 Species:Danio rerio


Alignment Length:237 Identity:55/237 - (23%)
Similarity:93/237 - (39%) Gaps:55/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VPPEAPKITQGDYLVTTEDREIELECVSQGGKPAA--EITWIDGLGNVLTKGIEYVKEPLADSRR 246
            |..|:..:..|..|.|..:..:.|.|::....|::  |:.|.        :....||.|   ...
Zfish    23 VTVESCPLAVGSLLQTAVEETVTLTCMTDNTDPSSQQELQWF--------RNGARVKLP---EEN 76

  Fly   247 ITARSILKLAP-KKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKV--IVSVVGGALAGGKIP 308
            :.:||.|.:.| .||.....||||.:..|.   .::.:..:|.|.|.:  .:.|.        :.
Zfish    77 MMSRSSLCVQPVTKEDDGAVFTCQLKGDAS---VNSTVEFDVSYPPDLNDTIEVF--------VQ 130

  Fly   309 EGAEVILSCQADANPHELSYRWFINDE---LMTGDF-------TTKMIIHNVSRQYHDAIVKCEV 363
            |..:.:|||:..||| .::..|..:.|   |.||.:       |.::.|..:.|..|..:..||.
Zfish   131 ETNDAVLSCEVRANP-PVTVVWKKDGEVLDLTTGSYKSTNNGITAQLTIPKLKRDVHQGLYVCET 194

  Fly   364 VNAVGKSEQSKKLDISFGPVFRQRPVSVE-----ADLGATVS 400
            .:|:            :|...|...|:||     ..||.|::
Zfish   195 KSAM------------YGVTGRTFQVTVEDRVIGFPLGPTIA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845
IG_like 88..182 CDD:214653
C2-set_2 189..279 CDD:285423 22/92 (24%)
Ig_2 307..379 CDD:290606 19/81 (23%)
I-set 382..462 CDD:254352 7/24 (29%)
IGc2 396..446 CDD:197706 2/5 (40%)
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
tmigd1NP_001091718.1 Ig 43..>100 CDD:299845 16/67 (24%)
IG_like 129..210 CDD:214653 22/93 (24%)
Ig 135..193 CDD:143165 15/58 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.