Sequence 1: | NP_001245505.1 | Gene: | kirre / 31292 | FlyBaseID: | FBgn0028369 | Length: | 956 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018174.2 | Gene: | lrit1a / 553943 | ZFINID: | ZDB-GENE-040924-5 | Length: | 643 | Species: | Danio rerio |
Alignment Length: | 268 | Identity: | 59/268 - (22%) |
---|---|---|---|
Similarity: | 89/268 - (33%) | Gaps: | 98/268 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 220 ITWID-GLGNVLTKGIEYVKEPLADSRRITARS---ILKLAPKKEHHNTTFTCQAQNTADRTYRS 280
Fly 281 AKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKM 345
Fly 346 IIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRPVSVEADLGATVSMRCDVAGNPE 410
Fly 411 PEIEW------------ISENSDQ-----VVGVAAELKLKVSSETAGRYFCKAVVNGFPEIGAEA 458
Fly 459 TLYVKRAP 466 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kirre | NP_001245505.1 | Ig | 87..183 | CDD:299845 | |
IG_like | 88..182 | CDD:214653 | |||
C2-set_2 | 189..279 | CDD:285423 | 16/62 (26%) | ||
Ig_2 | 307..379 | CDD:290606 | 10/71 (14%) | ||
I-set | 382..462 | CDD:254352 | 26/96 (27%) | ||
IGc2 | 396..446 | CDD:197706 | 19/66 (29%) | ||
Ig | 466..561 | CDD:299845 | 1/1 (100%) | ||
IG_like | 478..561 | CDD:214653 | |||
lrit1a | NP_001018174.2 | leucine-rich repeat | 61..84 | CDD:275378 | |
LRR_8 | 63..119 | CDD:290566 | |||
LRR_RI | <77..175 | CDD:238064 | 7/17 (41%) | ||
leucine-rich repeat | 85..108 | CDD:275378 | |||
LRR_8 | 108..167 | CDD:290566 | 3/9 (33%) | ||
leucine-rich repeat | 109..132 | CDD:275378 | |||
leucine-rich repeat | 133..156 | CDD:275378 | |||
leucine-rich repeat | 157..170 | CDD:275378 | 5/12 (42%) | ||
LRRCT | 199..243 | CDD:214507 | 13/68 (19%) | ||
I-set | 252..343 | CDD:254352 | 26/96 (27%) | ||
Ig | 259..333 | CDD:299845 | 23/79 (29%) | ||
fn3 | 448..515 | CDD:278470 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |