DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and iglon5

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:390 Identity:94/390 - (24%)
Similarity:142/390 - (36%) Gaps:102/390 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GDNGGQ--HFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNL-SGFERYSM--- 135
            |.:|.|  .|...|.:.|.:.|..|.|.|::.|:|....|      |.:...| :|.:::|:   
Zfish    20 GPSGAQAAEFGHLPDNITVLEGESVVLRCKIDEEVTHKAW------LNRSNILFTGTDKWSLDSR 78

  Fly   136 --VGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQGDYLV 198
              :.::...|||:.|..:|:.|:..|.|..    |.....|:....|.|.||.....|:|...: 
Zfish    79 VSLENNNNSDFSIRIERVMVADEGPYTCSF----QARNKPRTAHVYLIVQVPARIVNISQDKSV- 138

  Fly   199 TTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHN 263
             .|..::.|.|::. |:|...|||.|....:|.:|                 ..|::...|.|..
Zfish   139 -NEGEDVNLFCLAV-GRPEPTITWKDFKYGLLNEG-----------------EFLEITEIKRHQA 184

  Fly   264 TTFTCQAQN-TADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELS 327
            ..|.|...| .|....|..|  :.|.| |.:|..|.......||     ..||.|:|.|.| ..|
Zfish   185 EDFECITNNGVAPPDTRKVK--VTVNY-PPIITDVKNMPAQVGK-----TAILRCEAMAVP-TAS 240

  Fly   328 YRWFINDEL-MTGDFTTK---------MIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGP 382
            :.|:.:|.. :..|.|.|         ::..||:.: |.....|...|.:|.|..|..|   |.|
Zfish   241 FEWYRDDRRPVESDNTLKIKNEKTRSLLLFTNVTEK-HFGNYTCFASNRLGASNASMLL---FRP 301

  Fly   383 VFRQRPVSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKLKVSSETAGRYFCKAV 447
                         ||                         |.|.||.|..::|.  .|.:||.::
Zfish   302 -------------GA-------------------------VYGGAASLNGRLSG--VGLWFCLSI 326

  Fly   448  447
            Zfish   327  326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 24/101 (24%)
IG_like 88..182 CDD:214653 24/99 (24%)
C2-set_2 189..279 CDD:285423 20/90 (22%)
Ig_2 307..379 CDD:290606 21/81 (26%)
I-set 382..462 CDD:254352 12/66 (18%)
IGc2 396..446 CDD:197706 11/49 (22%)
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 24/99 (24%)
Ig 35..123 CDD:299845 23/97 (24%)
Ig 125..>183 CDD:299845 17/77 (22%)
I-set 128..207 CDD:254352 22/100 (22%)
IG_like 217..298 CDD:214653 22/87 (25%)
ig 223..296 CDD:278476 21/79 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.