DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and dpr12

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:267 Identity:56/267 - (20%)
Similarity:102/267 - (38%) Gaps:51/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 GKSEQSKKLDISFGPVFRQRPV---SVEADLGATVSMRCDVAGNPE-----PEIEWISENSDQVV 424
            |.|:....||.|..|:|....:   :....||.|..:.|.|:|...     .:|.||......::
  Fly    61 GDSKLDNNLDSSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHIL 125

  Fly   425 GVAAE--------------------LKLK-VSSETAGRYFCK-----AVVNGFPEIGAEATLYVK 463
            ...|:                    |::| |.....|.|.|:     .:::.|..:    .:.|.
  Fly   126 SSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNL----QVVVP 186

  Fly   464 RAPIITSHKVQFGGVGGRVKIDCLAFSIP-KAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGV 527
            .|.|:.|.::.. .:|..:.:.|:....| ..:::.|....::||...:..||.| |....|. .
  Fly   187 EAFILGSGELHV-DMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITI-ETTPGPR-T 248

  Fly   528 RAALIIRDSKATHFGKYNCTVMNS---------YGGDSLVITLLREPGNIPVLLVVMGSMFCVAI 583
            ::.||||:.:.|..|.|.|:..|:         ..||::.....|:..:...|..:..||....:
  Fly   249 QSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCL 313

  Fly   584 ILMIVMI 590
            :|..|::
  Fly   314 LLNTVVV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845
IG_like 88..182 CDD:214653
C2-set_2 189..279 CDD:285423
Ig_2 307..379 CDD:290606 4/10 (40%)
I-set 382..462 CDD:254352 19/113 (17%)
IGc2 396..446 CDD:197706 15/80 (19%)
Ig 466..561 CDD:299845 24/104 (23%)
IG_like 478..561 CDD:214653 22/92 (24%)
dpr12NP_652462.3 IG 86..183 CDD:214652 17/100 (17%)
Ig_3 193..271 CDD:404760 20/80 (25%)
Ig strand B 204..208 CDD:409353 0/3 (0%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.