DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and dpr6

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:391 Identity:81/391 - (20%)
Similarity:129/391 - (32%) Gaps:123/391 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PQDQTAVVGSRVTLPCRVMEKVG-ALQWTKDDFGLGQHRNL----------SGFERYSMVGSDEE 141
            |::.||::|....|.|||..... .:.|.:       ||::          :..:|:......:.
  Fly    80 PRNVTALMGKSAYLSCRVRNLANKTVSWIR-------HRDIHILTVGSYTYTSDQRFQATHHQDT 137

  Fly   142 GDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQGDYLVTTEDREIE 206
            .|::|.|......|...|:||:...|     :||.|.:|.|:||  ...|..|..|...:...|.
  Fly   138 EDWTLQIKWAQKRDAGMYECQISTQP-----VRSYFVRLNVVV
P--TATILGGPDLHVDKGSTIN 195

  Fly   207 LEC-VSQGGKPAAEITW------------------IDGLGNVLTKGIEYVKEPLADSRRITARSI 252
            |.| |....:|.|.|.|                  |...|:|.|..:......||||.:      
  Fly   196 LTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGK------ 254

  Fly   253 LKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILS- 316
                         ::|...|....:.|..  :|.|:            |:..|:.||..:...| 
  Fly   255 -------------YSCAPSNADVASVRVH--V
LNVR------------AIISGEHPEAMQTGSSG 292

  Fly   317 CQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFG 381
            ||         |.| :...|:.|      ::...|.|...:.|...:.:::              
  Fly   293 CQ---------YNW-LTIVLLLG------LVLCYSSQQCSSAVPASLTSSL-------------- 327

  Fly   382 PVFRQRPVSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKLKVSSETAGRYFCKA 446
            |:..|.|:...|  .||.:...:.|             |.:.|..|.......::.||.|..|.|
  Fly   328 PLPSQLPLPAAA--AATTTATGESA-------------SSESVTAARASAATTTTTTATRKRCPA 377

  Fly   447 V 447
            |
  Fly   378 V 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 24/105 (23%)
IG_like 88..182 CDD:214653 24/104 (23%)
C2-set_2 189..279 CDD:285423 21/108 (19%)
Ig_2 307..379 CDD:290606 12/72 (17%)
I-set 382..462 CDD:254352 16/66 (24%)
IGc2 396..446 CDD:197706 10/49 (20%)
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
dpr6NP_001287018.1 V-set 79..174 CDD:284989 24/105 (23%)
IG_like 80..175 CDD:214653 25/106 (24%)
IG_like 184..271 CDD:214653 20/107 (19%)
IGc2 191..262 CDD:197706 17/89 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.