DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and dpr5

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:334 Identity:74/334 - (22%)
Similarity:133/334 - (39%) Gaps:93/334 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 EVILSCQADANPHELSYRWFINDELMTG-----DFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSE 371
            :||.:.:|....||:...:|:...::.|     |..::.     |.||...:...|        |
  Fly    25 KVISNSRAPQIAHEMLVEYFMALLVIMGLTAPVDKQSRR-----SSQYFGHLAAAE--------E 76

  Fly   372 QSKKLDISF---GPVF-RQRPVSVEADLGATVSMRCDVAGNPEPEIEWIS--------------- 417
            .|..:..::   .||| ......|.|.||.|..:.|.|....:..:.||.               
  Fly    77 LSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYT 141

  Fly   418 ----------ENSDQVVGVAAELKL-KVSSETAGRYFCKAVVNGFPEIGAEATLYV--KRAPIIT 469
                      :|||:.|     ||: .|....||.|.|:  |:..|:|.....|.|  .:|.|:.
  Fly   142 NDQRFLARHIDNSDEWV-----LKIVSVQQRDAGVYECQ--VSTEPKISLAYKLVVVTSKAQILA 199

  Fly   470 SHKVQFGGVGGRVKIDCLAFSIPKA----EHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAA 530
            :.:: |...|..:.:.|:|   |:|    .|:||..:.:::: .||...|.:..|..:.   .:.
  Fly   200 NREL-FIQSGSDINLTCIA---PQAPGPYTHMLWHKDTELVS-DSARGGIRVESEQQMK---TSN 256

  Fly   531 LIIRDSKATHFGKYNCTVMNSYGGDSLVITLLR---------EPGN------IPVLLVVMGSMFC 580
            |:|...:.|..|.|.|:..|| ..||:.:.:::         |.|:      :|:||        
  Fly   257 LVISRVQHTDSGNYTCSADNS-NSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLL-------- 312

  Fly   581 VAIILMIVM 589
            :|::|::::
  Fly   313 LAVLLVVLL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845
IG_like 88..182 CDD:214653
C2-set_2 189..279 CDD:285423
Ig_2 307..379 CDD:290606 14/71 (20%)
I-set 382..462 CDD:254352 27/106 (25%)
IGc2 396..446 CDD:197706 17/75 (23%)
Ig 466..561 CDD:299845 24/98 (24%)
IG_like 478..561 CDD:214653 22/86 (26%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 24/102 (24%)
IG_like 98..179 CDD:214653 21/87 (24%)
IG_like 206..278 CDD:214653 20/79 (25%)
Ig 211..278 CDD:143165 19/74 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.