DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and Ama

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:335 Identity:72/335 - (21%)
Similarity:125/335 - (37%) Gaps:101/335 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QDQTAVVGSRVTLPCRVMEKVGAL--QWTK-------DDFGLGQHRNLSGF--ERYSMVGSD--E 140
            :|..|.||..|...|.| |:||.|  .|.|       :...|.. ||:...  :||::..::  :
  Fly    40 KDVVASVGDSVEFNCTV-EEVGQLSVSWAKRPSESDTNSVVLSM-RNILSLPDQRYNVTVTEGPK 102

  Fly   141 EGD--FSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLT------VLVPP----EAPKITQ 193
            .|.  ::..|..:.:.|...|:|||         :.|...|:|      :..||    ..||.| 
  Fly   103 TGSAIYTFRIQNIEVSDMGPYECQV---------LVSATEKVTKKLSLQI
KTPPVIAENTPKST- 157

  Fly   194 GDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPK 258
                :.||.:.:||.| ...|.|...|:|......|:..|...:.||     .:..||:.::   
  Fly   158 ----LVTEGQNLELTC-HANGFPKPTISWAREHNAVMPAGGHLLAEP-----TLRIRSVHRM--- 209

  Fly   259 KEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVI-----LSCQ 318
               ....:.|.|||...:..:.. :.:||::.|::.|          :.|:.|:::     |.|.
  Fly   210 ---DRGGYYCIAQNGEGQPDKRL-IRVEV
EFRPQIAV----------QRPKIAQMVSHSAELECS 260

  Fly   319 ADANP------------------HELSYRWFINDELMTGDFTTKMIIHNVSRQ----YHDAIVKC 361
            ....|                  ||::     |....:|..|:.:.|.:|..:    |:     |
  Fly   261 VQGYPAPTVVWHKNGVPLQSSRHHEVA-----NTASSSGTTTSVLRIDSVGEEDFGDYY-----C 315

  Fly   362 EVVNAVGKSE 371
            ...|.:|.::
  Fly   316 NATNKLGHAD 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 28/114 (25%)
IG_like 88..182 CDD:214653 28/113 (25%)
C2-set_2 189..279 CDD:285423 22/89 (25%)
Ig_2 307..379 CDD:290606 16/92 (17%)
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
AmaNP_731114.2 I-set 33..143 CDD:254352 28/113 (25%)
Ig 37..127 CDD:299845 23/88 (26%)
IG_like 154..234 CDD:214653 22/97 (23%)
IGc2 161..223 CDD:197706 18/73 (25%)
I-set 254..330 CDD:254352 14/82 (17%)
IGc2 254..322 CDD:197706 13/77 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.