DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and CG7166

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:308 Identity:76/308 - (24%)
Similarity:126/308 - (40%) Gaps:61/308 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VVGSRVTLPCRVMEKVGA--LQWTKDDFGL-GQHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDD 155
            :||..:.|||:| :.:|:  |.|.|....| ..|..::..:|:.:|     ||::|.|..:...|
  Fly    51 IVGETIELPCKV-QNLGSFVLLWRKGSSVLTAGHLKITRDQRFKIV-----GDYNLQINGVKTQD 109

  Fly   156 DAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQGDYLVTTEDREIELECVSQGGKPAAEI 220
            ...|.||:     |:|..|.:...:.:||||....:.....:...:...:.||| ...|.|...|
  Fly   110 AGDYICQL-----GDQENRDQVHTVEILV
PPTLRALPHNGQVTARKGSTVTLEC-KASGNPVPTI 168

  Fly   221 TWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQN-TADRTYRSAKLL 284
            .|             :.|:..:....::..|.|.|.....||..|:.|.|.| ..||.  |..:.
  Fly   169 FW-------------FKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRV--SMDIQ 218

  Fly   285 LEVKYAPKVIV--SVVGGALAGGKIPEGAEVILSC--QADANPHELSYRWFINDELMTGDFTTKM 345
            |.:...|::.|  |.|..:       ||.:|.|.|  ..|.|...|   |:.|..|:  |.|.:.
  Fly   219 LTILSPPEITVEKSWVHAS-------EGYDVELVCIVHGDVNSEML---WYQNSFLL--DATDRR 271

  Fly   346 IIHNVSRQYHDAIVK-----------CEVVNAVGKSEQSKKLDISFGP 382
            .::....:| ..|::           |...||:|:::  |.:::|..|
  Fly   272 SMYPRDDRY-SLIIRNFQPTDFGNYSCVADNALGRTK--KYIEVSGRP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 25/91 (27%)
IG_like 88..182 CDD:214653 25/90 (28%)
C2-set_2 189..279 CDD:285423 19/90 (21%)
Ig_2 307..379 CDD:290606 20/84 (24%)
I-set 382..462 CDD:254352 1/1 (100%)
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 25/92 (27%)
Ig 56..116 CDD:143165 18/65 (28%)
IG_like 144..221 CDD:214653 21/92 (23%)
IGc2 151..209 CDD:197706 17/71 (24%)
IG_like 232..313 CDD:214653 22/95 (23%)
Ig 242..311 CDD:143165 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.