DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and dpr10

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:392 Identity:67/392 - (17%)
Similarity:122/392 - (31%) Gaps:141/392 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SSSSSSSGSSSAAASSANDESKPKGGDNGGQHFAME-PQDQTAVVGSRVTLPCRVME-------- 107
            |.|:::..::.|..:.|.....|.|......:|.:. |::.|::||....|.|||..        
  Fly    23 SVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAW 87

  Fly   108 ---------KVGALQWTKDD-FGLGQHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQ 162
                     .||...:|.|. |....||::.              :::|.|......|...|:||
  Fly    88 IRHRDLHILTVGTYTYTTDQRFQTSYHRDID--------------EWTLQIKWAQQRDAGVYECQ 138

  Fly   163 VGPGPQGEQGIRSRFAKLTV--LVPPEAPKITQGDYLVTTEDREIELECVSQGGKPAAEITWIDG 225
            :...|     :||....|.:  |:..|...|.|                                
  Fly   139 ISTQP-----VRSYSVNLNIVDLIDAETSDIMQ-------------------------------- 166

  Fly   226 LGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYA 290
                                              :::|......|:|   |.|:|:.......:.
  Fly   167 ----------------------------------QYYNDDAFYIAEN---RVYQSSNDEFAGMFG 194

  Fly   291 PKVIVSVVGGALAGGK---IPEGAEVILSCQADANPHELSY-RWFINDELMTGDFTTKMIIHNVS 351
            |...|:|....:.||.   :.:|:.:.|:|....:|...:: .|:..|:::             |
  Fly   195 PIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVL-------------S 246

  Fly   352 RQYHDAIVKCEVVNAVGKSEQSKKL------DISFGPVFRQRPVSVEADLGATVSMRCDVAGNPE 410
            .:.....:|.:.:    |||::|.:      |:.....:...|.:.|     ..|:|..|.....
  Fly   247 EETSGGRLKFKTI----KSEETKSILLIYDADLLHSGKYSCYPSNTE-----IASIRVHVLQGER 302

  Fly   411 PE 412
            ||
  Fly   303 PE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 25/116 (22%)
IG_like 88..182 CDD:214653 25/111 (23%)
C2-set_2 189..279 CDD:285423 6/89 (7%)
Ig_2 307..379 CDD:290606 13/78 (17%)
I-set 382..462 CDD:254352 7/31 (23%)
IGc2 396..446 CDD:197706 5/17 (29%)
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
dpr10NP_729591.1 Ig 63..143 CDD:299845 20/93 (22%)
IG_like 210..297 CDD:214653 17/108 (16%)
IGc2 217..287 CDD:197706 14/86 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.