DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and dpr13

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:318 Identity:76/318 - (23%)
Similarity:113/318 - (35%) Gaps:88/318 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QPIAVHAKSKKNKSSQSSHHGDSSSSSSSSSSSSGSS---------------SAAASSANDESKP 74
            ||.|         .|.:|..|.|.:|..|::...|.|               |.:...|.|.:.|
  Fly    87 QPYA---------QSAASAGGSSITSFDSTNVIDGQSQPTPTHLQEAVLQTHSHSRIQAKDTAGP 142

  Fly    75 -----------------KGGDNGG--------QHFAMEPQDQTAV---VGSRVTLPCRVME-KVG 110
                             ..|..||        .:|..|  :.|.|   :|:...:||.|.. ..|
  Fly   143 YPIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTE--NSTVVTTQIGATAHVPCTVHHIGEG 205

  Fly   111 ALQW-TKDDF-----GLGQHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQG 169
            .:.| .|.|:     ||..:   |..||:|........|::|.|..:.|.|...|:|||...|. 
  Fly   206 VVSWIRKKDYHLLTVGLTTY---SSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPP- 266

  Fly   170 EQGIRSRFAKLTVLVPPEA-PKITQGDYLVTTEDREIELEC-VSQGGKPAAEITWIDG---LGNV 229
                .|.|..|:|:   || .:||.......|....:.|:| |.|..:.:..|.|...   :...
  Fly   267 ----TSIFLHLSVV---EARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMINYD 324

  Fly   230 LTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEV 287
            :.:||....||...|..:|      :...:..|:..|||.|.||     :.|.:|:.:
  Fly   325 IDRGINVSTEPDFQSSELT------IQRTRREHSGNFTCVASNT-----QPASVLVHI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 30/105 (29%)
IG_like 88..182 CDD:214653 29/103 (28%)
C2-set_2 189..279 CDD:285423 22/93 (24%)
Ig_2 307..379 CDD:290606
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
dpr13NP_001033956.2 V-set 180..276 CDD:284989 30/105 (29%)
IG_like 182..262 CDD:214653 24/82 (29%)
IG_like 285..362 CDD:214653 18/82 (22%)
IGc2 292..361 CDD:197706 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.