DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and ImpL2

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:244 Identity:55/244 - (22%)
Similarity:97/244 - (39%) Gaps:55/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 EVVNAVGKSEQSKKLDISFGPVF----RQRPVSVEADLGATVSMRCDVAGNPEPEIEWI------ 416
            :|.|:: ::|:.|..:.:|...:    :..|..::...|||:.:.|::.|:..|.|:|:      
  Fly    36 DVDNSI-EAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPR 99

  Fly   417 SE----NSDQVVGVAAELKLKVSS--------ETAGRYFCKAVVNGFPEIGAEATLYVKRAPIIT 469
            ||    :|:||...|....::|.|        ..|..|.|.. ..|...|.|...::..|:..:|
  Fly   100 SELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVG-RTGSKTIYASTVVHPPRSSRLT 163

  Fly   470 SHKVQFGG---------------VGGRVKIDCLAFSIPKAEHILWSFEGKIINMSSADPDIYIFE 519
            ..|...|.               :|..:::.|...:.|:|| |.|        :::.:.:|....
  Fly   164 PEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAE-ITW--------LNNENKEIVQGH 219

  Fly   520 EHH-LPEGVRAALIIRDSKATHFGKYNCTVMNSYG---GDSLVITLLRE 564
            .|. |..|   .|:|.:.|....|.|.|...|..|   .|:.|..:|.|
  Fly   220 RHRVLANG---DLLISEIKWEDMGNYKCIARNVVGKDTADTFVYPVLNE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845
IG_like 88..182 CDD:214653
C2-set_2 189..279 CDD:285423
Ig_2 307..379 CDD:290606 4/16 (25%)
I-set 382..462 CDD:254352 23/101 (23%)
IGc2 396..446 CDD:197706 19/67 (28%)
Ig 466..561 CDD:299845 24/113 (21%)
IG_like 478..561 CDD:214653 21/86 (24%)
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 18/75 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.