DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and dpr20

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:349 Identity:71/349 - (20%)
Similarity:121/349 - (34%) Gaps:113/349 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KKNKSSQ--SSHHGDSSSSSSSSSSSSG-SSSAAASSANDESKPKGGDNG--------------- 80
            |||.|.|  .|.:.::...::.:::||| .||:.||.|......:....|               
  Fly   168 KKNASFQQIGSQNVNALVPATVATTSSGLPSSSNASLATPTEPARNRSTGLVRNSAVKVDSKHPL 232

  Fly    81 -------------------------------GQHF-----AMEPQDQTAVVGSRVTLPCRV---M 106
                                           |.||     ..:..:.|...||.:.|.||:   .
  Fly   233 SKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQ 297

  Fly   107 EKVGALQW----TKDD----------FGLGQHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDDDA 157
            :|  .:.|    |:|:          ..:|.| ..:|.:||.| ......::.|.|..:..||:|
  Fly   298 DK--TVSWVRHNTQDEGKDNGNALDLLTVGMH-TYTGDKRYKM-EFQYPNNWRLKITNVKKDDEA 358

  Fly   158 KYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKI----TQGDYLVTTE---DREIELECVSQGGK 215
            .|:||:...|       .|..::.:.|  .|||:    ..||.|....   |..::|.||.:...
  Fly   359 IYECQISTHP-------PRVIQINLHV--NAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVA 414

  Fly   216 PAAEITWIDGLGNVL----TKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADR 276
            ..:.:.:...:.|:|    |:|...||..|.:.   .|.|.|.:|...:..:..:||......:.
  Fly   415 MTSSVVFWKHMDNILNYDVTRGGVSVKTELMED---GANSTLSIAKISKTDSGNYTCSISEFQNF 476

  Fly   277 TYRSAKLLLEVKYAPKVIVSVVGG 300
            |               ::|.::.|
  Fly   477 T---------------IVVHILNG 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 26/112 (23%)
IG_like 88..182 CDD:214653 26/110 (24%)
C2-set_2 189..279 CDD:285423 23/100 (23%)
Ig_2 307..379 CDD:290606
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
dpr20NP_612066.1 IG_like 278..365 CDD:214653 24/90 (27%)
Ig 279..378 CDD:299845 26/109 (24%)
Ig 400..471 CDD:299845 17/73 (23%)
IG_like 402..480 CDD:214653 17/95 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.