DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and wrapper

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:238 Identity:55/238 - (23%)
Similarity:90/238 - (37%) Gaps:39/238 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 CEVVNAVGKSEQSKKLDISFGPVFRQRPVSV-EADLGATVSMRCDVAGNPEPEIEW------ISE 418
            ||:.:..|...|...:::...|.....|..: |..:||...:.|:..|.|:|.|.|      |..
  Fly   111 CEMNSDSGHVVQQH
AIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQP 175

  Fly   419 NSDQVVGVAAELKLKVSSET-AGRYFCKAVVNGFPEIG-AEATLYVKRAPIIT-SHKVQFGGVGG 480
            .|:  .|....|.|::.|.. ||...|.| .||..|.. |...|:|..:|.:: ...|.:..:|.
  Fly   176 QSN--TGNRQSLILEIKSRNQAGLIECVA-SNGVGEPAVANVYLHVL
FSPEVSIPQPVVYTKLGS 237

  Fly   481 RVKIDCLAFSIPKAEHILW--------------SFEGKIINMSSADPDIYIFEEHHLPEGVRAAL 531
            |..::|:..:.|.|. :.|              :.|.::....|.|         |....||..|
  Fly   238 RAHLECIVEAAPAAT-VKWFHHGLPVALGAHSTTHESELQTNRSVD---------HYVNAVRHML 292

  Fly   532 IIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVV 574
            :::..:....|:|.|...|.....|..:.|...|  :|.|..:
  Fly   293 VVKSVRNADMGQYECRASNQISVKSGSVELTGRP--MPCLFKI 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845
IG_like 88..182 CDD:214653
C2-set_2 189..279 CDD:285423
Ig_2 307..379 CDD:290606 4/17 (24%)
I-set 382..462 CDD:254352 26/88 (30%)
IGc2 396..446 CDD:197706 17/56 (30%)
Ig 466..561 CDD:299845 20/109 (18%)
IG_like 478..561 CDD:214653 18/96 (19%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 4/12 (33%)
IG_like 41..118 CDD:214653 2/6 (33%)
IG_like 145..218 CDD:214653 23/75 (31%)
Ig 147..219 CDD:299845 23/74 (31%)
I-set 224..323 CDD:254352 19/108 (18%)
IGc2 236..314 CDD:197706 17/87 (20%)
FN3 339..431 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.