DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and LRIT3

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_940908.3 Gene:LRIT3 / 345193 HGNCID:24783 Length:679 Species:Homo sapiens


Alignment Length:230 Identity:60/230 - (26%)
Similarity:88/230 - (38%) Gaps:61/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 PEG------AEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNA 366
            |.|      :.:||..|  .||      ||.:..:      :|||  .:|:....|||..:.:..
Human   183 PSGVLDLSPSRIILGLQ--DNP------WFCDCHI------SKMI--ELSKVVDPAIVLLDPLMT 231

  Fly   367 VGKSE-------QSKKLDISFGPVFRQRPVSVEADLGATVSMRCDVAGNPEPEIEW--------- 415
            ..:.|       |..:|:....|........:.:.||:.|.:|||..|.|.|:|.|         
Human   232 CSEPERLTGILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQITWTRSDSSPVN 296

  Fly   416 ---ISENSDQVVGVAAELKLKVSSETAGRYFCKAV-VNGFPEIGAEAT-LYVKRAPI--ITSHK- 472
               |.|:.::.|..:......:||:.||.|.|||. :.|..|.....| |.:...||  .||.: 
Human   297 YTVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVTVTVLGITTTPIPPDTSERT 361

  Fly   473 -------VQFGGVGGRVKIDCLAFSIPKAEHILWS 500
                   ||.|  .||      :.|:..|...|||
Human   362 GDHPEWDVQPG--SGR------STSVSSASSYLWS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845
IG_like 88..182 CDD:214653
C2-set_2 189..279 CDD:285423
Ig_2 307..379 CDD:290606 19/83 (23%)
I-set 382..462 CDD:254352 27/93 (29%)
IGc2 396..446 CDD:197706 19/61 (31%)
Ig 466..561 CDD:299845 14/45 (31%)
IG_like 478..561 CDD:214653 7/23 (30%)
LRIT3NP_940908.3 LRR 1 56..79
leucine-rich repeat 59..82 CDD:275378
LRR_8 61..117 CDD:290566
LRR 2 80..103
leucine-rich repeat 83..106 CDD:275378
LRR 3 104..128
LRR_8 105..165 CDD:290566
LRR_4 105..146 CDD:289563
leucine-rich repeat 107..130 CDD:275378
LRR 4 129..151
LRR_4 131..170 CDD:289563
leucine-rich repeat 131..154 CDD:275378
LRR 5 152..175
leucine-rich repeat 155..168 CDD:275378
Ig 267..345 CDD:299845 24/77 (31%)
IG_like 267..345 CDD:214653 24/77 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..375 7/25 (28%)
FN3 486..550 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.