DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and dpr19

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:377 Identity:75/377 - (19%)
Similarity:121/377 - (32%) Gaps:108/377 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 VGKSEQSKKLDISFGPVFR-----QRPVSVEADLGATVSMRCDVAGNPEPEIEWISENSDQV--V 424
            |||...|:.   .||...:     :....|.|..|....:.|.|..|....:.||.....|:  |
  Fly    24 VGKITSSQN---HFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTV 85

  Fly   425 GVAA------------------ELKLK-VSSETAGRYFCK-------------AVVNGFPEIGAE 457
            |::.                  .|::| |..|..|.|.|:             .:|....||.:.
  Fly    86 GLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIVEAVAEISSA 150

  Fly   458 ATLYVKRAPIITSHKVQFGGVGGRVKIDC-LAFSIPKAEHILWSFEGKIINMSS----------- 510
            ..|::...              ..::::| |..:......:.|..:.|:||..|           
  Fly   151 PELHIDET--------------STLRLECKLKRATENPAFVFWYHDSKMINYDSQGGFVVTSIGQ 201

  Fly   511 ADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREP-GNIPVLLVV 574
            ::|....|.........||.:.:..|..         |:||..|.|   ..::.| .|:|.....
  Fly   202 SNPQSGQFYRSSPANKSRATMPMESSNG---------VLNSLLGSS---DAIKAPAANVPSSTPY 254

  Fly   575 MGSMFCVAIILMIVMIIIVYRKRRSR---------KKPMPADVIPEASRGGDKLNELKSELRSKA 630
            |......|.:|...:.::..::...|         ....||.:.....| |:|...::...|| .
  Fly   255 MTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLR-GEKTAAMQHANRS-I 317

  Fly   631 YDVEYSEAGGDGLAINLTQSPMPDVQMKG--ATLGVPLAGPVKFDERFSGDF 680
            .|.|.:..|..||           :.:.|  .|.||.|||.:.:   |||.|
  Fly   318 LDTETNGNGTFGL-----------ITLGGLNGTSGVTLAGGILY---FSGLF 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845
IG_like 88..182 CDD:214653
C2-set_2 189..279 CDD:285423
Ig_2 307..379 CDD:290606 4/11 (36%)
I-set 382..462 CDD:254352 22/118 (19%)
IGc2 396..446 CDD:197706 16/83 (19%)
Ig 466..561 CDD:299845 17/106 (16%)
IG_like 478..561 CDD:214653 17/94 (18%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 18/76 (24%)
IGc2 55..125 CDD:197706 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.