DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and bdl

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:485 Identity:100/485 - (20%)
Similarity:162/485 - (33%) Gaps:120/485 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 AMEPQDQT---AVVGSRVTLPCRVMEKVGA-----LQWTKDDFGLGQHRNLSGFERYSMVGSDEE 141
            |.:.:.||   |.|||.|...|.:.....|     :.||||        |...|..|....|..|
  Fly    34 ARDHRRQTNLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKD--------NKKIFTWYEQETSTSE 90

  Fly   142 ---------------GDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKL--------TVL 183
                           |..|:::..:...|...|.|||. .|.....:|:.....        .:.
  Fly    91 LFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVS-FPNRSPSVRNNGTAYHLAVQGGSLIR 154

  Fly   184 VPPEAPKITQGDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRIT 248
            :||....|.:|        :.....||.:..:.:....:.||   ||.:.:    :.|.....:.
  Fly   155 IPPVNQTIREG--------QTAFFHCVMKHPENSQASWYKDG---VLLQEV----QDLVRRFYMG 204

  Fly   249 ARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEV 313
            ....|.:.|........:.|:.:| :|...::||..|.::|..|||.     |.....:|.|...
  Fly   205 PDGSLSIDPTMMSDLGEYECKVRN-SDGELQTAKAFLNIQYKAKVIY-----APPEVFLPYGQPA 263

  Fly   314 ILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVS--------RQYHDAIVKCEVVNAVGKS 370
            :|.|...|||...:.|| ..|.|:...:....:.:.::        .:.|.....|...|.:|..
  Fly   264 VLDCHFRANPPLKNLRW-EKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTD 327

  Fly   371 EQSKKLDISF--GPVFRQRPVSVEAD-LGATVSMRC---DVAGNPEPEIEW-------------- 415
            ..|..:.:..  .|:|...|.::... ||....:.|   |..||..|.|.|              
  Fly   328 GPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPADRFS 392

  Fly   416 ISENSDQVVGVAAELKLKVSSETAGRYFCKAVVNGFPEIGAEATLYVK----RAPI-ITSHKVQF 475
            :|..:..:.|:.        ....|.|.|.| .|....|.|||.|.::    |||. :|::..: 
  Fly   393 LSGGNLTITGLV--------EGDRGIYECSA-TNEAATITAEAELMIENIAPRAPYNLTANSTE- 447

  Fly   476 GGVGGRVKIDCL------AFSIPKAEHILW 499
                     .|:      .:..|..|:.:|
  Fly   448 ---------TCITIRWQPGYLRPNLEYTVW 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 27/126 (21%)
IG_like 88..182 CDD:214653 27/124 (22%)
C2-set_2 189..279 CDD:285423 14/89 (16%)
Ig_2 307..379 CDD:290606 16/79 (20%)
I-set 382..462 CDD:254352 24/97 (25%)
IGc2 396..446 CDD:197706 13/66 (20%)
Ig 466..561 CDD:299845 6/41 (15%)
IG_like 478..561 CDD:214653 4/28 (14%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 22/93 (24%)
Ig 43..131 CDD:299845 23/96 (24%)
I-set 153..242 CDD:254352 19/104 (18%)
Ig 157..242 CDD:299845 18/100 (18%)
Ig_2 252..337 CDD:290606 16/85 (19%)
IG_like 260..327 CDD:214653 14/67 (21%)
I-set 341..428 CDD:254352 23/95 (24%)
IGc2 356..419 CDD:197706 15/71 (21%)
FN3 435..524 CDD:238020 8/44 (18%)
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.