DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and dpr3

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:347 Identity:67/347 - (19%)
Similarity:120/347 - (34%) Gaps:121/347 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSQSSHHGDSSSSSSSSSSSSGSSSAAAS--------------------------SANDESKPKG 76
            ||||......::|:|:||.||.||.|.|.                          :..|..:.:.
  Fly   155 SSQSQSPSPPAASASASSPSSFSSFAVAHGPQTEATNHTFKSLAFLDASFGSDLFAQTDAKRERS 219

  Fly    77 G--DNGGQ-----------HFAMEPQDQTAVVG-SRVTLPCRV-----------------MEKVG 110
            |  |...|           .|.| |::.|...| :...:.|||                 :..||
  Fly   220 GAADEESQDADTSQSLPIFDFGM-PRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVG 283

  Fly   111 ALQWTKDDFGLGQHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIR- 174
            ...:|.|             :|:.:..|.:..:::|.:...:..|...|:|||...|:.....: 
  Fly   284 TATYTSD-------------KRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQL 335

  Fly   175 -----SRFAKLTVLVPP----------------EAPKIT--------QGDYLVT---TEDREIEL 207
                 |..||..:..||                :.|.:.        :|::::|   .:|.:.|:
  Fly   336 NIIEISPDAKAVISGPPDLHFKAGSAIILNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQPEI 400

  Fly   208 ECVSQGGKPAA--EITWIDGLGNVLTKGIEY-----VKEPLADSRRITARSILKLAPKKEHHNTT 265
            . ..:|..|..  |.|..:.:.:.:...:|:     ::..|.|    |.:|.|:::..:......
  Fly   401 P-AGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGD----TLKSRLRISNAQTTDTGN 460

  Fly   266 FTCQAQNTADRTYRSAKLLLEV 287
            :|||     ..|..||.:|:.|
  Fly   461 YTCQ-----PTTASSASVLVHV 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 22/119 (18%)
IG_like 88..182 CDD:214653 22/117 (19%)
C2-set_2 189..279 CDD:285423 19/107 (18%)
Ig_2 307..379 CDD:290606
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
dpr3NP_001014459.2 Ig 243..330 CDD:299845 19/99 (19%)
IG_like 243..329 CDD:214653 19/98 (19%)
Ig 350..464 CDD:299845 18/118 (15%)
IG_like <441..477 CDD:214653 11/44 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.