DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and CG33543

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:396 Identity:91/396 - (22%)
Similarity:146/396 - (36%) Gaps:107/396 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LILTLLLQPIAVHAKSKKNKSSQSSHHGDSSSSSSSSSSSSGSSSAAASSANDESKPKGGDNGGQ 82
            |:|.||.|..|:                   .....|:||.||.:..|......:.|        
  Fly    10 LLLLLLSQNAAI-------------------LGQLDSTSSGGSGTGGAPPDRPPTPP-------- 47

  Fly    83 HFAMEPQDQ--TAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHR-NLSGFERYSMVGSDEEGDF 144
             .:::|...  |..|.....:.|:.::|....:| :|.  .||.| |..|...   :.....|..
  Fly    48 -LSLQPSTPSITHFVNESFIIFCQTVQKDIDTKW-RDP--RGQTRENTKGRVH---IEKKTTGLL 105

  Fly   145 SLDIYPLMLDDDAKYQCQVGPGPQGEQGI---RSRFAKLTVLVPPEAPKITQG---DYLVTTEDR 203
            :|....:.|:|...:.|:|.....|.:.:   |...|...:||   ..||:.|   ......|.|
  Fly   106 ALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLV---NQKISFGKTEQVQSVREGR 167

  Fly   204 EIELECVSQGGKPAAEITWI----------DGLGNVLTKGIEYVKEPLADSRRITARSILKLAPK 258
            :..:.|..: |.||.|::|:          ....|.|:.|:.......||:...|.|: :::.| 
  Fly   168 DAMVNCFVE-GMPAPEVSWLYNGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRA-MRITP- 229

  Fly   259 KEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAP--------KVIVSVVGGALAGGKIPEGAEVIL 315
                  ||:...|.|         :||.:::.|        .|..:.||||           |.|
  Fly   230 ------TFSDSDQIT---------ILLRIQHKPHWFFNETLPVQYAYVGGA-----------VNL 268

  Fly   316 SCQADANPHELSYRWFINDELMTG--------DF--TTKMIIHNVSRQYHDAIVKCEVVNAVGKS 370
            ||.|...|.. |:.|..|::.:.|        |:  |.::.:.|.| |:.|  .||:|.|.:|..
  Fly   269 SCDAMGEPPP-SFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNAS-QFGD--YKCKVANPLGML 329

  Fly   371 EQSKKL 376
            |:..||
  Fly   330 ERVIKL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 21/101 (21%)
IG_like 88..182 CDD:214653 21/99 (21%)
C2-set_2 189..279 CDD:285423 23/102 (23%)
Ig_2 307..379 CDD:290606 24/80 (30%)
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 14/59 (24%)
IG_like 256..336 CDD:214653 29/95 (31%)
IGc2 263..327 CDD:197706 23/78 (29%)
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.