DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and DIP-beta

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:411 Identity:93/411 - (22%)
Similarity:157/411 - (38%) Gaps:110/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 AMEP------QDQTAVVGSRVTLPCRVMEKVGA-------------LQWTKDD----FGLGQHRN 126
            |.||      ::.|...|...|..| |:..:|.             :.|.|.|    ..:.:| .
  Fly    95 AFEPDFVIPLENVTIAQGRDATFTC-VVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEH-V 157

  Fly   127 LSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPE-APK 190
            ::..:|.| |..::...::|:|..:.::|..||.|||...|     ::.:.|.|.|::||: ..:
  Fly   158 ITNNDRLS-VQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDP-----MKMQTATLEVVIPPDIINE 216

  Fly   191 ITQGDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARS---- 251
            .|.||.:| .|....:|.|.:: |.|..:|||                 ...|.|.|.||:    
  Fly   217 ETSGDMMV-PEGGSAKLVCRAR-GHPKPKITW-----------------RREDGREIIARNGSHQ 262

  Fly   252 ----------ILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIV--SVVGGALAG 304
                      :|.|:.........:.|.|.|....|. |.::.|:|.:.|.|.|  .:||.    
  Fly   263 KTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTV-SKRMKLQVHFHPLVQVPNQLVGA---- 322

  Fly   305 GKIPEGAEVILSCQADANPHELSYRWFINDE-LMTGD-----------FTTKMIIHNVSRQYHD- 356
               |...:|.|.|..:|:|..::|....|.| ::.||           :..:||:|....|..| 
  Fly   323 ---PVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDF 384

  Fly   357 AIVKCEVVNAVGKSEQSKKL-----------------DISFGPVFRQRPVSVEADLGATVSMRCD 404
            ...||...|::|.:|.:.:|                 ::|...|.::...|.:........:..|
  Fly   385 GGYKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKD 449

  Fly   405 VAGNPEPEIEWISENSDQVVG 425
            .|.:..|     :..|||::|
  Fly   450 RAPDQHP-----ASGSDQLLG 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 26/118 (22%)
IG_like 88..182 CDD:214653 25/116 (22%)
C2-set_2 189..279 CDD:285423 23/103 (22%)
Ig_2 307..379 CDD:290606 22/101 (22%)
I-set 382..462 CDD:254352 9/44 (20%)
IGc2 396..446 CDD:197706 7/30 (23%)
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 26/118 (22%)
ig 102..195 CDD:278476 21/95 (22%)
IG_like 219..307 CDD:214653 24/107 (22%)
Ig 221..307 CDD:299845 23/105 (22%)
Ig 311..404 CDD:299845 26/99 (26%)
IG_like 327..405 CDD:214653 20/77 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.