DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and dpr9

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:349 Identity:74/349 - (21%)
Similarity:109/349 - (31%) Gaps:128/349 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SSHHGDSSSSSSSSSSSSGSSSAAASSANDESKPKGGDNGGQHFAME-PQDQTAVVGSRVTLPCR 104
            ||.|..||:||::.||...|.....|...:|::     |.|.:|... .::.||::|....|.||
  Fly   220 SSLHKASSASSNTFSSQLASGFHRNSIDLEEAR-----NAGPYFDKAFSKNVTALLGKTAYLNCR 279

  Fly   105 VM---EKVGALQ--WTKDDFGLGQHRNL----------SGFERYSMVGSDEEGDFSLDI-YPLML 153
            |.   .|...||  |.:       ||::          :..:|:..:...:..|:.|.| || ..
  Fly   280 VKNLGNKTMLLQVSWVR-------HRDIHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYP-QH 336

  Fly   154 DDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQGDYLVTTEDREIELECVSQGG-KPA 217
            .|...|:|||...|.     .|.:..|.|:.|  :.:|.....|.......|.|.|:.|.. :|.
  Fly   337 RDSGIYECQVSTTPH-----MSHYIHLNVVEP--STEIIGAPDLYIESGSTINLTCIIQNSPEPP 394

  Fly   218 AEITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAK 282
            |.|.|                                      :||..|....|           
  Fly   395 AYIFW--------------------------------------NHNNAFPSHPQ----------- 410

  Fly   283 LLLEVKY-APKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMI 346
               .:.| :|:..||||..                                     .||.||..:
  Fly   411 ---IINYDSPRGGVSVVTN-------------------------------------KGDTTTSFL 435

  Fly   347 IHNVSRQYHDAIVKCEVVNAVGKS 370
            :...:|.......:|...||..||
  Fly   436 LIKSARPSDSGHYQCNPSNAKPKS 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 27/112 (24%)
IG_like 88..182 CDD:214653 27/109 (25%)
C2-set_2 189..279 CDD:285423 14/90 (16%)
Ig_2 307..379 CDD:290606 10/64 (16%)
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
dpr9NP_001287332.1 Ig 263..361 CDD:299845 27/110 (25%)
IG_like 263..360 CDD:214653 27/109 (25%)
IG_like 371..464 CDD:214653 29/178 (16%)
IGc2 377..456 CDD:197706 25/167 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.