DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and NEGR1

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:321 Identity:69/321 - (21%)
Similarity:125/321 - (38%) Gaps:66/321 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLS-----GFERYSM-----VGSDEEGDFSLDIYP 150
            |....|.|          :.:|....|...|.|     |.:::|:     :.:..:.|:||.|..
Human    53 GDTAVLRC----------YLEDGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQN 107

  Fly   151 LMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQGDYLVTTEDREIELECVSQGGK 215
            :.:.||..|.|.|    |.:...|:....|||.|||:...|:..  :...|...:.|.|::. ||
Human   108 VDVTDDGPYTCSV----QTQHTPRTMQVHLTV
QVPPKIYDISND--MTVNEGTNVTLTCLAT-GK 165

  Fly   216 PAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRS 280
            |...|:|         :.|....:|..:.:.:....|.:      .....:.|.|:|  |.::..
Human   166 PEPSISW---------RHISPSAKPFENGQYLDIYGITR------DQAGEYECSAEN--DVSFPD 213

  Fly   281 A-KLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFIND-ELMTG---- 339
            . |:.:.|.:||.:      ..:..|.:..|...::.|:....|.. ::.|:..: :|..|    
Human   214 VRKVKVVVNFAPTI------QEIKSGTVTPGRSGLIRCEGAGVPPP-AFEWYKGEKKLFNGQQGI 271

  Fly   340 ---DFTTKMI--IHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFRQRPVSVEADL 395
               :|:|:.|  :.||: |.|.....|...|.:|.:..|..|:   .|...|..::..||:
Human   272 IIQNFSTRSILTVTNVT-QEHFGNYTCVAANKLGTTNASLPLN---PPSTAQYGITGSADV 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 22/96 (23%)
IG_like 88..182 CDD:214653 21/95 (22%)
C2-set_2 189..279 CDD:285423 16/89 (18%)
Ig_2 307..379 CDD:290606 18/81 (22%)
I-set 382..462 CDD:254352 4/14 (29%)
IGc2 396..446 CDD:197706 69/321 (21%)
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
NEGR1NP_776169.2 IG 47..135 CDD:214652 21/95 (22%)
IGc2 152..210 CDD:197706 15/75 (20%)
Ig_3 225..301 CDD:372822 16/83 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.