DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and Lrit1

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_666357.2 Gene:Lrit1 / 239037 MGIID:2385320 Length:624 Species:Mus musculus


Alignment Length:393 Identity:87/393 - (22%)
Similarity:147/393 - (37%) Gaps:101/393 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VPPEAPKITQGDYLVTTEDREIELECVSQGGKPAA--EITW-----IDGLGNVLTKGIEYVKE-P 240
            :||:..|:.    |..|..|.:..|..    :|.:  |..|     :..|..::.:|:..::| .
Mouse    57 IPPDTCKLR----LERTAIRRVPGETF----RPLSRLEQLWLPYNALSELSALMLRGLRRLRELR 113

  Fly   241 LADSRRIT------------------ARSILKLAPKKEH--HNTTFTCQAQNTADRTYRSAKLLL 285
            |..:|.:|                  |..:..|.|:..|  .|.||...:.|   :..|..:.||
Mouse   114 LPGNRLVTFPWAALRDTPQLQLLDLQANRLSTLPPEAAHFLENLTFLDLSNN---QLMRLPEELL 175

  Fly   286 EVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNV 350
            :|....|     .|..|:|    ..|.:||..|  .||.....|.:....|:.|..::.:|    
Mouse   176 DVWAHLK-----TGPFLSG----HHARLILGLQ--DNPWVCDCRLYDLVHLLDGWVSSNLI---- 225

  Fly   351 SRQYHDAIVKCEVVNAV-GKSEQSKKLDISFGPVFRQRPVSVEADLGATVSMRCDVAGNPEPEIE 414
               :.:|.::|....:: |.:....:|.....|..|....|:.:.||:||.:||...|.|.||:.
Mouse   226 ---FIEARLRCASPRSLAGVAFSQLELRKCQSPELRPGVTSIISPLGSTVLLRCGATGIPGPEMS 287

  Fly   415 WISENSDQVVGVAAELKLKVSSE---------------TAGRYFCKAVVNGFPEIGAEATLYVKR 464
            |...|...:.|...:   :|||:               .:|.|.|:|  ..|  :||..||.   
Mouse   288 WRRANGRPLNGTVHQ---EVSSDGSSWTLLDLPVVSLFDSGDYICQA--KNF--LGASETLI--- 342

  Fly   465 APIITSHKVQFG--GVGGRVKIDCLAFSIPKAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGV 527
            :.|:|..:...|  |:.|                :||:..|:....::.:..:......|:||.|
Mouse   343 SLIVTEPQTSTGYSGIPG----------------VLWARTGEGAEAAAYNNKLVARHVPHMPEHV 391

  Fly   528 RAA 530
            ..|
Mouse   392 ALA 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845
IG_like 88..182 CDD:214653
C2-set_2 189..279 CDD:285423 22/117 (19%)
Ig_2 307..379 CDD:290606 14/72 (19%)
I-set 382..462 CDD:254352 28/94 (30%)
IGc2 396..446 CDD:197706 18/64 (28%)
Ig 466..561 CDD:299845 13/67 (19%)
IG_like 478..561 CDD:214653 9/53 (17%)
Lrit1NP_666357.2 LRRNT 23..61 CDD:214470 2/3 (67%)
LRR 1 60..81 5/28 (18%)
LRR_8 63..143 CDD:290566 15/87 (17%)
leucine-rich repeat 64..84 CDD:275378 5/27 (19%)
LRR 2 84..105 3/20 (15%)
leucine-rich repeat 85..132 CDD:275378 8/46 (17%)
LRR 3 108..129 4/20 (20%)
LRR_8 131..>176 CDD:290566 10/47 (21%)
LRR_4 131..172 CDD:289563 9/43 (21%)
LRR 4 132..153 3/20 (15%)
leucine-rich repeat 133..156 CDD:275378 4/22 (18%)
LRR 5 156..177 7/23 (30%)
leucine-rich repeat 157..180 CDD:275378 7/25 (28%)
leucine-rich repeat 181..205 CDD:275378 10/34 (29%)
TPKR_C2 201..>241 CDD:301599 8/46 (17%)
Ig 258..346 CDD:299845 27/97 (28%)
IG_like 268..346 CDD:214653 25/87 (29%)
FN3 432..502 CDD:214495
LRR 6 526..549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.