DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and Ntm

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001344522.1 Gene:Ntm / 235106 MGIID:2446259 Length:367 Species:Mus musculus


Alignment Length:323 Identity:72/323 - (22%)
Similarity:124/323 - (38%) Gaps:65/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ANDESKPKGGDNGGQHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFER 132
            :.|.:.||..||           .|...|...||.|.:..:|..:.|......|     .:|.::
Mouse    33 SGDATFPKAMDN-----------VTVRQGESATLRCTIDNRVTRVAWLNRSTIL-----YAGNDK 81

  Fly   133 YSM-----VGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKIT 192
            :.:     :.|:.:..:|::|..:.:.|:..|.|.|    |.:...::....|.|.|.|:..:|:
Mouse    82 WCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSV----QTDNHPKTSRVHLIVQVSPKIVEIS 142

  Fly   193 QGDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAP 257
            ..  :...|...|.|.|::. |:|...:||    .::..|.:.:|.|.          ..|::..
Mouse   143 SD--ISINEGNNISLTCIAT-GRPEPTVTW----RHISPKAVGFVSED----------EYLEIQG 190

  Fly   258 KKEHHNTTFTCQAQN-TADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADA 321
            .....:..:.|.|.| .|....|..|  :.|.|.|.:      ....|..:|.|.:..|.|:|.|
Mouse   191 ITREQSGEYECSASNDVAAPVVRRVK--VTVNYPPYI------SEAKGTGVPVGQKGTLQCEASA 247

  Fly   322 NPHELSYRWFINDE-LMTG---------DFTTKMIIHNVSRQYHD-AIVKCEVVNAVGKSEQS 373
            .| ...::||.:|: |:.|         .|.:|:...|||.  || ....|...|.:|.:..|
Mouse   248 VP-SAEFQWFKDDKRLVEGKKGVKVENRPFLSKLTFFNVSE--HDYGNYTCVASNKLGHTNAS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 18/100 (18%)
IG_like 88..182 CDD:214653 18/98 (18%)
C2-set_2 189..279 CDD:285423 17/90 (19%)
Ig_2 307..379 CDD:290606 23/78 (29%)
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
NtmNP_001344522.1 Ig 44..132 CDD:416386 19/107 (18%)
Ig strand A' 44..49 CDD:409353 2/15 (13%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 1/5 (20%)
Ig strand C 64..70 CDD:409353 1/5 (20%)
CDR2 71..83 CDD:409353 2/16 (13%)
Ig strand C' 72..76 CDD:409353 1/8 (13%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 7/37 (19%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 1/5 (20%)
Ig strand F 110..118 CDD:409353 3/11 (27%)
CDR3 119..123 CDD:409353 0/3 (0%)
Ig strand G 123..132 CDD:409353 1/8 (13%)
FR4 125..132 CDD:409353 1/6 (17%)
Ig_3 136..205 CDD:404760 16/85 (19%)
Ig strand A' 144..148 CDD:409353 0/5 (0%)
Ig strand B 151..160 CDD:409353 3/8 (38%)
Ig strand F 197..205 CDD:409353 2/7 (29%)
Ig_3 222..299 CDD:404760 22/85 (26%)
putative Ig strand A 223..229 CDD:409353 1/11 (9%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.