Sequence 1: | NP_001245505.1 | Gene: | kirre / 31292 | FlyBaseID: | FBgn0028369 | Length: | 956 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001344522.1 | Gene: | Ntm / 235106 | MGIID: | 2446259 | Length: | 367 | Species: | Mus musculus |
Alignment Length: | 323 | Identity: | 72/323 - (22%) |
---|---|---|---|
Similarity: | 124/323 - (38%) | Gaps: | 65/323 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 ANDESKPKGGDNGGQHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFER 132
Fly 133 YSM-----VGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKIT 192
Fly 193 QGDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAP 257
Fly 258 KKEHHNTTFTCQAQN-TADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADA 321
Fly 322 NPHELSYRWFINDE-LMTG---------DFTTKMIIHNVSRQYHD-AIVKCEVVNAVGKSEQS 373 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kirre | NP_001245505.1 | Ig | 87..183 | CDD:299845 | 18/100 (18%) |
IG_like | 88..182 | CDD:214653 | 18/98 (18%) | ||
C2-set_2 | 189..279 | CDD:285423 | 17/90 (19%) | ||
Ig_2 | 307..379 | CDD:290606 | 23/78 (29%) | ||
I-set | 382..462 | CDD:254352 | |||
IGc2 | 396..446 | CDD:197706 | |||
Ig | 466..561 | CDD:299845 | |||
IG_like | 478..561 | CDD:214653 | |||
Ntm | NP_001344522.1 | Ig | 44..132 | CDD:416386 | 19/107 (18%) |
Ig strand A' | 44..49 | CDD:409353 | 2/15 (13%) | ||
Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 64..70 | CDD:409353 | 1/5 (20%) | ||
Ig strand C | 64..70 | CDD:409353 | 1/5 (20%) | ||
CDR2 | 71..83 | CDD:409353 | 2/16 (13%) | ||
Ig strand C' | 72..76 | CDD:409353 | 1/8 (13%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 7/37 (19%) | ||
Ig strand D | 87..94 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 97..103 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/11 (27%) | ||
CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 123..132 | CDD:409353 | 1/8 (13%) | ||
FR4 | 125..132 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 136..205 | CDD:404760 | 16/85 (19%) | ||
Ig strand A' | 144..148 | CDD:409353 | 0/5 (0%) | ||
Ig strand B | 151..160 | CDD:409353 | 3/8 (38%) | ||
Ig strand F | 197..205 | CDD:409353 | 2/7 (29%) | ||
Ig_3 | 222..299 | CDD:404760 | 22/85 (26%) | ||
putative Ig strand A | 223..229 | CDD:409353 | 1/11 (9%) | ||
Ig strand B | 239..243 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 252..256 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 278..282 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 292..297 | CDD:409353 | 1/4 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |