DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and Iglon5

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:351 Identity:80/351 - (22%)
Similarity:132/351 - (37%) Gaps:72/351 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AAASSANDESKPKGGDNGGQHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNL 127
            |||:.|......:|..:....|:....:.|...|...||.|.:.|.|..:.|      |.:...|
Mouse    14 AAAALAGLAVISRGLLSQSLEFSSPADNYTVCEGDNATLSCFIDEHVTRVAW------LNRSNIL 72

  Fly   128 -SGFERYS-------MVGSDEEGDFSLDIYPLMLDDDAKYQC--QVGPGPQGEQGIRSRFAKLTV 182
             :|.:|::       ::.:.||  ||:.|..:.|.|:..|.|  |....|...|      ..|.|
Mouse    73 YAGNDRWTSDPRVRLLINTPEE--FSILITQVGLGDEGLYTCSFQTRHQPYTTQ------VYLIV 129

  Fly   183 LVPPEAPKITQGDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRI 247
            .||.....|:..  :...|...:.|.|::. |:|...:||........::|              
Mouse   130 HVPARIVNISSP--VAVNEGGNVNLLCLAV-GRPEPTVTWRQLRDGFTSEG-------------- 177

  Fly   248 TARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAE 312
               .||:::..:......:.|...|..:....|.::|:.|.| |..|..|.....|.|:     .
Mouse   178 ---EILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNY-PPTITDVTSARTALGR-----A 233

  Fly   313 VILSCQADANPHELSYRWFINDELMTG----------DFTTKMIIH-NVSRQYHDAIVKCEVVNA 366
            .:|.|:|.|.| ...::|:.:|.|::.          :.|..|::. |||.: |.....|...|.
Mouse   234 ALLRCEAMAVP-PADFQWYKDDRLLSSGSAEGLKVQTERTRSMLLFANVSAR-HYGNYTCRAANR 296

  Fly   367 VGKSEQSKKLDISFGPVFRQRPVSVE 392
            :|.|..|.:|         .||.|:|
Mouse   297 LGASSASMRL---------LRPGSLE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 25/105 (24%)
IG_like 88..182 CDD:214653 25/103 (24%)
C2-set_2 189..279 CDD:285423 13/89 (15%)
Ig_2 307..379 CDD:290606 20/82 (24%)
I-set 382..462 CDD:254352 4/11 (36%)
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 25/101 (25%)
Ig strand A' 41..46 CDD:409353 1/4 (25%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 1/3 (33%)
FR2 61..68 CDD:409353 2/12 (17%)
Ig strand C 61..67 CDD:409353 1/11 (9%)
CDR2 69..79 CDD:409353 2/9 (22%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 9/36 (25%)
Ig strand D 84..91 CDD:409353 0/6 (0%)
Ig strand E 94..100 CDD:409353 3/7 (43%)
Ig strand F 107..115 CDD:409353 2/7 (29%)
CDR3 116..120 CDD:409353 0/3 (0%)
Ig strand G 120..129 CDD:409353 3/14 (21%)
FR4 122..129 CDD:409353 2/12 (17%)
Ig strand A 132..137 CDD:409353 1/4 (25%)
Ig_3 134..199 CDD:404760 12/84 (14%)
Ig strand A' 140..145 CDD:409353 0/6 (0%)
Ig strand B 148..157 CDD:409353 2/8 (25%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 2/4 (50%)
Ig strand F 191..199 CDD:409353 1/7 (14%)
Ig_3 217..295 CDD:404760 20/84 (24%)
putative Ig strand A 218..224 CDD:409353 1/5 (20%)
Ig strand B 234..238 CDD:409353 1/3 (33%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 1/4 (25%)
Ig strand G 301..304 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.