DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and zig-2

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:214 Identity:51/214 - (23%)
Similarity:80/214 - (37%) Gaps:51/214 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 FRQRPVSVEADLGATVSMRCDVAGNPEPEIEW------------------ISENSDQVVG---VA 427
            |.:.|.......|....:.|...|.|.|.|.|                  |..:..||..   |:
 Worm    35 FTRTPNDSNVTFGEKFVLSCGANGAPLPSIYWELNGMRIQGEETSNVYENILNDGKQVSNAAMVS 99

  Fly   428 AELKLK-VSSETAGRYFCKAVVNGFPEIGAEATLYV-----------KRAPIITSHKVQFGGVGG 480
            :..::. .::..:|.|.| .:.||..::...|.::|           ..||.| |..|.|     
 Worm   100 SHYRIPCATARNSGAYKC-IIDNGLTKLEHVAKVFV
GGNKTNCALNDNGAPFI-SMTVDF----- 157

  Fly   481 RVKI--DCLAFSIPKAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGK 543
            |::|  :.:|.|........||:. |...:.:.|.:.|    ...|.|   .||||:...:..|:
 Worm   158 RLEISNNAVALSCRSETATEWSWH-KGEQLLTNDGERY----QMFPSG---DLIIRNISWSDMGE 214

  Fly   544 YNCTVMNSYGGDSLVITLL 562
            ||||..|.: |::..||.|
 Worm   215 YNCTARNHF-GETTAITFL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845
IG_like 88..182 CDD:214653
C2-set_2 189..279 CDD:285423
Ig_2 307..379 CDD:290606
I-set 382..462 CDD:254352 19/99 (19%)
IGc2 396..446 CDD:197706 14/71 (20%)
Ig 466..561 CDD:299845 28/96 (29%)
IG_like 478..561 CDD:214653 23/84 (27%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 19/99 (19%)
Ig 34..121 CDD:299845 16/86 (19%)
Ig <179..232 CDD:299845 19/61 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.