DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and zig-4

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:226 Identity:49/226 - (21%)
Similarity:86/226 - (38%) Gaps:60/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 AKLTVLVPPEAPKITQGDYLVTTEDREIELECVSQGGKPAAEITW------IDGLG--NVLTKGI 234
            ||:.::.|.|:..|..|      |..::..:.:|   .|||.|.|      |.|..  ||..|.:
 Worm    44 AKIKIVAPLESALIPGG------ETYQLRCDIMS---TPAATIHWKFNGKLIQGSNELNVEEKLL 99

  Fly   235 EYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEV------------ 287
            .:.| .:.|:..:.  |||.:......::.|::|...|    .:::.:.:.||            
 Worm   100 NFGK-AIVDTGIVA--SILTIQCPSAENSGTYSCVGYN----GHQTIETVAEVEIEGEASGCRSN 157

  Fly   288 -KYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELM----------TGDF 341
             |.||:::..........|.:     ..|.|:|:   .::.:.|..||||:          .||.
 Worm   158 HKSAPEIVFWTDSRFEMTGNV-----ATLVCRAN---QQVDWVWMSNDELVKNNDKFTVLSNGDL 214

  Fly   342 TTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQ 372
            ..|.|:.:....|     .|...|..|::.|
 Worm   215 VIKNIVWDDMGTY-----TCIARNQFGEARQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 2/4 (50%)
IG_like 88..182 CDD:214653 2/3 (67%)
C2-set_2 189..279 CDD:285423 22/97 (23%)
Ig_2 307..379 CDD:290606 17/76 (22%)
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
zig-4NP_509335.1 I-set 47..147 CDD:254352 26/115 (23%)
Ig 65..144 CDD:143165 19/88 (22%)
IG_like 176..245 CDD:214653 18/78 (23%)
Ig <193..238 CDD:299845 13/49 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.