Sequence 1: | NP_001245505.1 | Gene: | kirre / 31292 | FlyBaseID: | FBgn0028369 | Length: | 956 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038943864.1 | Gene: | Dscam / 171119 | RGDID: | 619992 | Length: | 2034 | Species: | Rattus norvegicus |
Alignment Length: | 686 | Identity: | 141/686 - (20%) |
---|---|---|---|
Similarity: | 230/686 - (33%) | Gaps: | 202/686 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 PIAVHAKSKKNKSS---QSSHHGDSSSSSSSSSSSSGSSSAAASSANDESKPKGGDNGGQHFAME 87
Fly 88 PQDQT-------AVVGSRVTLPCRVM-EKVGALQWTKDD--FGLGQHRNLSGFERYSMVGSDEEG 142
Fly 143 DFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQG-DYLVTTEDREIE 206
Fly 207 LECVSQGGKPAAEITW-------IDGLGNVLTKGIEYVKEPLADSRRITAR----SILKLAPKKE 260
Fly 261 HHNTTFTCQAQNTAD--------------------------------------------RTYRSA 281
Fly 282 KLLL------------------------EVKYAPKVIV----SVVGGALAGGKIPE--------- 309
Fly 310 ---GAEVILSC-------------QADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAI 358
Fly 359 VKCEVVNAVGKSEQSKKLDISFGPVFRQRPVSVEADLGATVSMRCDVAGNPEPEIEW-------- 415
Fly 416 -----ISENSD-QVVGVAAELKLKVSSETAGRYFCKAVVNGFPEIGAEAT----LYVKRAPIITS 470
Fly 471 H-KVQFGGVGGRVKIDCLAFSIPKAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIR 534
Fly 535 DSKATHFGKYNCTVMNSYGGDSLVITL-LREPGNIP 569 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kirre | NP_001245505.1 | Ig | 87..183 | CDD:299845 | 20/105 (19%) |
IG_like | 88..182 | CDD:214653 | 20/103 (19%) | ||
C2-set_2 | 189..279 | CDD:285423 | 21/145 (14%) | ||
Ig_2 | 307..379 | CDD:290606 | 20/96 (21%) | ||
I-set | 382..462 | CDD:254352 | 27/97 (28%) | ||
IGc2 | 396..446 | CDD:197706 | 18/63 (29%) | ||
Ig | 466..561 | CDD:299845 | 27/95 (28%) | ||
IG_like | 478..561 | CDD:214653 | 24/82 (29%) | ||
Dscam | XP_038943864.1 | Ig | 26..121 | CDD:416386 | |
Ig strand A' | 33..37 | CDD:409353 | |||
Ig strand B | 40..49 | CDD:409353 | |||
Ig strand C | 55..61 | CDD:409353 | |||
Ig strand C' | 63..66 | CDD:409353 | |||
Ig strand D | 72..75 | CDD:409353 | |||
Ig strand E | 80..85 | CDD:409353 | |||
Ig strand F | 98..106 | CDD:409353 | |||
Ig strand G | 109..121 | CDD:409353 | |||
Ig | 125..210 | CDD:416386 | |||
Ig strand A | 126..130 | CDD:409353 | |||
Ig strand A' | 132..136 | CDD:409353 | |||
Ig strand B | 139..149 | CDD:409353 | |||
Ig strand C | 157..163 | CDD:409353 | |||
Ig strand C' | 164..167 | CDD:409353 | |||
Ig strand E | 179..185 | CDD:409353 | |||
Ig strand F | 191..201 | CDD:409353 | |||
IGc2 | 239..300 | CDD:197706 | 7/35 (20%) | ||
Ig strand B | 242..246 | CDD:409353 | |||
Ig strand C | 255..259 | CDD:409353 | |||
Ig strand F | 290..295 | CDD:409353 | 1/4 (25%) | ||
Ig | 313..395 | CDD:416386 | 19/92 (21%) | ||
Ig strand A | 314..319 | CDD:409353 | 1/4 (25%) | ||
Ig strand A' | 322..326 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 329..339 | CDD:409353 | 5/9 (56%) | ||
Ig strand C | 344..350 | CDD:409353 | 2/5 (40%) | ||
Ig strand C' | 351..354 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 368..374 | CDD:409353 | 1/16 (6%) | ||
Ig strand F | 381..389 | CDD:409353 | 4/7 (57%) | ||
Ig | 406..501 | CDD:416386 | 21/108 (19%) | ||
Ig strand A | 406..409 | CDD:409353 | 1/2 (50%) | ||
Ig strand A' | 415..419 | CDD:409353 | 1/3 (33%) | ||
Ig strand B | 422..431 | CDD:409353 | 2/9 (22%) | ||
Ig strand C | 436..442 | CDD:409353 | 2/5 (40%) | ||
Ig strand C' | 444..447 | CDD:409353 | 0/2 (0%) | ||
Ig strand D | 452..460 | CDD:409353 | 2/20 (10%) | ||
Ig strand E | 464..473 | CDD:409353 | 2/8 (25%) | ||
Ig strand F | 480..488 | CDD:409353 | 2/7 (29%) | ||
Ig strand G | 491..501 | CDD:409353 | 0/9 (0%) | ||
Ig | 504..593 | CDD:416386 | 9/88 (10%) | ||
Ig strand A | 505..507 | CDD:409353 | 0/1 (0%) | ||
Ig strand A' | 512..516 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 519..526 | CDD:409353 | 0/6 (0%) | ||
Ig strand C | 533..539 | CDD:409353 | 0/5 (0%) | ||
Ig strand C' | 540..542 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 549..553 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 557..563 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 571..579 | CDD:409353 | 2/7 (29%) | ||
Ig strand G | 583..593 | CDD:409353 | 1/9 (11%) | ||
Ig | 596..686 | CDD:416386 | 20/94 (21%) | ||
Ig strand A | 597..599 | CDD:409353 | 0/1 (0%) | ||
Ig strand B | 611..620 | CDD:409353 | 2/8 (25%) | ||
Ig strand C | 625..632 | CDD:409353 | 0/6 (0%) | ||
Ig strand C' | 634..636 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 643..648 | CDD:409353 | 1/4 (25%) | ||
Ig strand E | 651..658 | CDD:409353 | 2/6 (33%) | ||
Ig strand F | 665..673 | CDD:409353 | 1/7 (14%) | ||
Ig strand G | 676..685 | CDD:409353 | 1/8 (13%) | ||
Ig_DSCAM | 689..784 | CDD:409397 | 27/98 (28%) | ||
Ig strand B | 707..711 | CDD:409397 | 1/3 (33%) | ||
Ig strand C | 720..724 | CDD:409397 | 1/3 (33%) | ||
Ig strand E | 749..753 | CDD:409397 | 0/3 (0%) | ||
Ig strand F | 763..768 | CDD:409397 | 3/5 (60%) | ||
Ig strand G | 777..780 | CDD:409397 | 0/2 (0%) | ||
Ig_DSCAM | 785..884 | CDD:409398 | 29/102 (28%) | ||
Ig strand B | 805..809 | CDD:409398 | 0/3 (0%) | ||
Ig strand C | 818..822 | CDD:409398 | 0/3 (0%) | ||
Ig strand E | 848..852 | CDD:409398 | 1/3 (33%) | ||
Ig strand F | 862..867 | CDD:409398 | 1/4 (25%) | ||
Ig strand G | 875..878 | CDD:409398 | 0/2 (0%) | ||
FN3 | 885..978 | CDD:238020 | 2/5 (40%) | ||
FN3 | 986..1083 | CDD:238020 | |||
FN3 | 1091..1184 | CDD:238020 | |||
FN3 | 1189..1278 | CDD:238020 | |||
Ig_3 | 1287..1363 | CDD:404760 | |||
Ig strand B | 1303..1307 | CDD:409353 | |||
Ig strand C | 1316..1320 | CDD:409353 | |||
Ig strand E | 1342..1346 | CDD:409353 | |||
Ig strand F | 1356..1361 | CDD:409353 | |||
FN3 | 1380..1470 | CDD:238020 | |||
FN3 | 1486..1555 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |