DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kirre and LOC110439986

DIOPT Version :9

Sequence 1:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:XP_021333824.1 Gene:LOC110439986 / 110439986 -ID:- Length:358 Species:Danio rerio


Alignment Length:393 Identity:105/393 - (26%)
Similarity:155/393 - (39%) Gaps:92/393 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 PEAPKITQGDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITAR 250
            |:.|.|:.....|..|...:.|.|.|....||...:|..|             |....|.||.  
Zfish    19 PDTPVISINRSAVIKEGDSVTLNCSSNANPPALNFSWFKG-------------ETFVGSSRIF-- 68

  Fly   251 SILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPK-VIVSVVGGALAGGKIPEGAEVI 314
            :|.|::   ...|..:.|:|:|.....| |..:.|:|:|.|: :.||:...|:    |..|..|.
Zfish    69 NISKIS---SDDNKKYKCKAKNDLGEKY-SDPVTLDVQYPPRNISVSMNRSAV----IMSGDSVT 125

  Fly   315 LSCQADAN-PHELSYRWFINDELMTGD---FTTKMIIHNVSRQYHDAIVKCEVVNAVG-KSEQSK 374
            |||.:|:| |.|:|  |: ..|...|.   |....|..:.|.:|     ||...|..| |.....
Zfish   126 LSCSSDSNPPAEIS--WY-KGETSVGSGRIFNISKISSDDSGEY-----KCRARNDHGEKYSDPV 182

  Fly   375 KLDISFGP----VFRQRPVSVEADLGATVSMRCDVAGNPEPEIEWI----SENSDQVVGVAAELK 431
            .||:.:.|    :..:..|.:|.|   :|::.|....||.....|.    |.||.::..::    
Zfish   183 TLDVQYAPDTPVISNRSAVIMEGD---SVTLNCSSNSNPPANFSWFKGNKSLNSGRIFSIS---- 240

  Fly   432 LKVSSETAGRYFCKA-VVNGFPEIGAEATLYVKRAPIITSHKVQFGGV---GGRVKIDCLAFSIP 492
             |:||:.:|.|.|:| .|:| .:.....||.|:..|...|..:....|   |..|.:.|.:.|.|
Zfish   241 -KISSDDSGEYKCRARNVHG-EKYSDPVTLDVQYPPRNISVSMNRSAVIMSGDSVTLSCSSDSNP 303

  Fly   493 KAEHILWSFE-------GKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMN 550
            .|| |.| |:       |:|.|:|....|                    ||     |:|.|...|
Zfish   304 PAE-INW-FKGETSVRSGRIFNISKISSD--------------------DS-----GEYKCRYKN 341

  Fly   551 SYG 553
            .:|
Zfish   342 IHG 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845
IG_like 88..182 CDD:214653
C2-set_2 189..279 CDD:285423 21/89 (24%)
Ig_2 307..379 CDD:290606 25/76 (33%)
I-set 382..462 CDD:254352 23/88 (26%)
IGc2 396..446 CDD:197706 14/53 (26%)
Ig 466..561 CDD:299845 25/98 (26%)
IG_like 478..561 CDD:214653 23/86 (27%)
LOC110439986XP_021333824.1 Ig_2 22..101 CDD:316418 24/97 (25%)
Ig_2 115..186 CDD:316418 25/82 (30%)
Ig_2 193..270 CDD:316418 22/85 (26%)
Ig_2 284..355 CDD:316418 23/88 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D141865at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.